KEGG   Klebsiella michiganensis E718: A225_4827Help
Entry
A225_4827         CDS       T02173                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00071  Fatty acid degradation
koe00280  Valine, leucine and isoleucine degradation
koe00310  Lysine degradation
koe00362  Benzoate degradation
koe00380  Tryptophan metabolism
koe00620  Pyruvate metabolism
koe00630  Glyoxylate and dicarboxylate metabolism
koe00640  Propanoate metabolism
koe00650  Butanoate metabolism
koe00900  Terpenoid backbone biosynthesis
koe01100  Metabolic pathways
koe01110  Biosynthesis of secondary metabolites
koe01120  Microbial metabolism in diverse environments
koe01130  Biosynthesis of antibiotics
koe01200  Carbon metabolism
koe01212  Fatty acid metabolism
koe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:koe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A225_4827
   00630 Glyoxylate and dicarboxylate metabolism
    A225_4827
   00640 Propanoate metabolism
    A225_4827
   00650 Butanoate metabolism
    A225_4827
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A225_4827
   00072 Synthesis and degradation of ketone bodies
    A225_4827
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A225_4827
   00310 Lysine degradation
    A225_4827
   00380 Tryptophan metabolism
    A225_4827
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A225_4827
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A225_4827
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A225_4827
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:koe04147]
    A225_4827
Enzymes [BR:koe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A225_4827
Exosome [BR:koe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A225_4827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFN34040
Position
complement(5069320..5070498)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTPIGCFQGALSRHSAVELGSVVVKALVERSGVDPQSIDEVILGQVLTAG
TGQNPARQSAIRGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAWAL
SSQHKARRAIDSGRFRDEIVPVTSELNGTPRLVDTDEQPRVDPSAEALASLLPTFDQQGS
VTAGNASSINDGAAAVMMMSEAKAEELGLPILARIRAFASVGVDPALMGIAPVHATRRCL
ERAGWKLDEVDLIEANEAFAAQAISVGRVLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMIKRDARKGLATLCIGGGQGVALAVERE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtaatcgtcggcgcgttgcgaacgccaatcggctgttttcagggcgcg
ctgtcgcgtcattcggcggtggagctgggcagcgtggtggtgaaggcgcttgttgagcgc
agcggcgtcgatccgcaaagtattgatgaggtgatcctcggccaggtgctgacggcagga
accggacagaatccggcgcgtcagtcggcgatccgcggcgggctgccaaacaccgtttct
gctattaccatcaacgacgtctgcggttccggactgaaggcgctgcacctggcgacccag
gcgattcagtgcggcgaagcggacgtagtgatcgccggcgggcaggagaatatgagccgc
gcccctcacgtgctgaccgacagccgtaccggcgcccagttgggcaatagccagcttatc
gacagccttgtccacgatggcctgtgggatgcgtttaacgactaccatatgggcgtgacg
gcggagaacctggcgcgcgagtatggcatcagccgtgaactgcaggatgcgtgggcgctt
agctcgcagcacaaagcgcggcgggcgattgattccggacgctttcgcgatgaaatcgtg
ccggtgaccagcgaactcaacggtactccgcgcctggtggataccgatgagcagccgcgc
gtcgaccccagcgcagaagcgctggccagcctgctgccgacctttgaccagcagggctcg
gtcaccgccggcaatgcctcaagcattaacgatggcgcggcggcggtgatgatgatgagc
gaagctaaagccgaggagctggggctgccgattctggcgcggatccgcgcttttgccagc
gtgggcgtcgatccggcgctgatggggatcgcgccggtccatgccacccgtcgctgcctt
gaacgcgcgggctggaagctggatgaagtcgatcttatcgaagccaacgaagcctttgcc
gctcaggccatttcggtgggcagggtactggaatgggacgagcggcgggtgaacgtgaac
ggcggcgccattgcgctgggccacccgattggcgcttccggctgccgcattctggtttcc
ctggtgcacgagatgattaaacgcgatgcccgcaaagggctggccacgctatgcatcggc
ggcggccagggcgtggcgctggcggtggaacgcgaataa

DBGET integrated database retrieval system