KEGG   Klebsiella oxytoca KONIH1: KONIH1_00330Help
Entry
KONIH1_00330      CDS       T03269                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kok  Klebsiella oxytoca KONIH1
Pathway
kok00052  Galactose metabolism
kok00500  Starch and sucrose metabolism
kok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kok00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KONIH1_00330
   00500 Starch and sucrose metabolism
    KONIH1_00330
Enzymes [BR:kok01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KONIH1_00330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C EMP24_GP25L Amb_V_allergen
Motif
Other DBs
NCBI-ProteinID: AID87570
Position
69386..71074
Genome map
AA seq 562 aa AA seqDB search
MSLSFNIKQGQRIDLWLKASEPAAQPLFSIRVNGQVVFKIQEAPRYFQYFTWTSFQDGVA
TLEWLPEYSEISLCYTWHPDSLRARGVTFIATAGQDLRLMSGQDIVDEYLREPLRPALHF
SPRTGWMNDPNGLHYKNGEWHLFYQYHPHSSQWGPMHWNHAVSRDLYHWRHYPVFLQPEQ
NLSALGATGGAFSGSAYIDKQGKTRFWYTERLPAYDLYRGYREVQKMAVAHDDYDKPEWV
KTVLTDLPAGVDCDFRDPKVWYEEADATFYMILGASVNGDPAMLLFHSADSERWTFHHVL
YVAPGYFRENGGRCVECPDFFCLDGVWVLIIGVVGYKEPTTGRHNLLFAQTGTFRNGYFT
PSEQPLQTLDFGTDFYALQTWGEDDRRIGFAWLYNWATQKPVDSAYSGEMSLPRRFHLNA
QQRLCMMPELPPESLVVSRHALDDGDIWVNEKGCKAGIVTFMPAGGFRLTLTGDSGQQII
LEQEGKNLTLYEKGRDDGRYRAPVPSVSDVTLCFDAGIVEVFANQGSVCGTRRYYSCSQL
TRIQLSGAPAQLTQYRSTYSQE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgtcatttaatattaaacaaggtcagcgcattgatttgtggctgaaagcgtcc
gaaccggcggcgcaacccctgttttctattcgcgtgaacggtcaggttgtatttaagatt
caggaggcgccgcgctacttccagtattttacctggacctcgtttcaggacggcgttgcc
accctggagtggctgccggaatatagcgagatatcgctttgttacacctggcatccggat
tcactgcgcgcgcgcggcgttacctttatcgcgacagccgggcaggatttgcgcctgatg
agcggtcaggatattgttgacgagtatctgcgggagccgctgcgtccggcattgcatttc
tcgccccgtaccggctggatgaacgaccctaacgggctgcactacaagaacggcgagtgg
catctgttttaccagtatcatccgcactccagccaatggggcccaatgcactggaatcat
gcggtgagccgcgatctgtatcactggcggcattatccggttttcctccagccagagcag
aatctttccgcgctgggcgcgacgggcggcgcgttttccggcagcgcgtatattgataaa
caaggaaaaacccgcttctggtataccgaacggctcccggcttacgatctgtatcgcggc
taccgggaagtgcagaaaatggccgttgcgcacgacgactacgataagccggaatgggtg
aaaaccgtcttaaccgacctgcctgcgggcgtggactgcgatttccgcgatccaaaagtg
tggtacgaagaggccgatgccaccttttatatgatcctcggcgcctcggtaaacggcgat
ccggcgatgctgctatttcactctgcggatagtgaacgctggacgttccatcatgtgctg
tatgtcgctcccggctattttcgcgaaaacggcggtcgctgcgtcgaatgcccggatttc
ttctgcctggatggcgtatgggtattaattatcggcgtcgttggctacaaggagccgaca
accgggcggcataatttgctttttgcccagaccggtactttccggaacggctatttcacg
ccgtccgagcagccgctacagactttagatttcggtacggatttctacgccctgcaaacc
tggggtgaggacgaccgaagaatcggctttgcctggttatataactgggcgacgcagaaa
ccggtggattccgcttactcgggggaaatgtcgctcccgcgtcgctttcatctcaatgcg
cagcagcggctatgcatgatgccggagctgccgccggaatcattggtcgtcagccgccat
gcgctggatgacggtgatatctgggttaatgagaaaggctgtaaagccggcattgtaacc
tttatgcctgccggtggtttccgtttgacgttaacgggcgatagcggtcagcaaatcatc
ctcgaacaggagggtaaaaatctgacgctatatgaaaaaggccgggacgatgggcgttac
cgcgcgccggtgcccagcgtcagcgacgtcacgctgtgttttgatgccgggattgttgag
gtcttcgcaaatcagggcagcgtatgcggtacgcgacgctattactcatgcagtcagctc
acccggatccagctctccggcgcgccggcacagcttacgcaatatcgctcgacgtattcg
caggaataa

DBGET integrated database retrieval system