KEGG   Klebsiella oxytoca KONIH1: KONIH1_00350Help
Entry
KONIH1_00350      CDS       T03269                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
kok  Klebsiella oxytoca KONIH1
Pathway
kok00010  Glycolysis / Gluconeogenesis
kok00071  Fatty acid degradation
kok00350  Tyrosine metabolism
kok00625  Chloroalkane and chloroalkene degradation
kok00626  Naphthalene degradation
kok01100  Metabolic pathways
kok01110  Biosynthesis of secondary metabolites
kok01120  Microbial metabolism in diverse environments
kok01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KONIH1_00350
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KONIH1_00350
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    KONIH1_00350
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KONIH1_00350
   00626 Naphthalene degradation
    KONIH1_00350
Enzymes [BR:kok01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KONIH1_00350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AID87574
Position
complement(74391..75539)
Genome map
AA seq 382 aa AA seqDB search
MSFMLALPKISLHGAGAIGDMVKLVAGKRWGKALIVTDGQLVKLGLLDSLFTALDEQQMS
YHLFDEVFPNPTEALVQKGYAAYREAGCDYLIAFGGGSPIDTAKAIKILTANPGPSTAYS
GVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDAERQVKEVIIDPNIIPDIAVDDASVML
DIPPSITAATGMDALTHAIEAFVSVGAHPLTDANALEAIRLINQWLPQAVDDGHNLEARE
QMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIIENFNRPNAVARFA
RVAQAMGVDTRGMSDEAASMEAINAIRALSKRVGIPQGFSQLGVSKADIEGWLDKALADP
CAPCNPRTASRDEVRELYLEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagttttatgttggcactgcccaaaatcagcctccacggcgcgggcgcaatcggcgat
atggtcaagctggtggcgggtaaacgctggggcaaagcgctgatcgtcaccgacggccag
ctggtgaagctggggctgctcgacagcctgtttaccgccctggatgaacagcagatgtct
taccatctgtttgacgaggtgttccctaacccaacggaagcgctggtgcaaaaaggctac
gcggcgtatcgggaggccggatgtgattaccttatcgccttcggcggcggcagcccgatt
gataccgccaaagcgataaaaatcctcaccgccaacccggggccatcgaccgcctattcc
ggcgtcggcaaagtgaaaaacgccggcgtgccgctggtggccatcaacacgaccgccggc
accgcggcggagatgaccagcaacgcggttattatcgacgccgagcgccaggtaaaagag
gtgattatcgaccccaatatcattcccgatatcgccgtcgatgacgccagcgtaatgctg
gatatcccgccgtccattaccgccgccaccggcatggacgcgctgacccacgccattgaa
gcctttgtttccgttggcgcgcacccgctgaccgatgccaatgccctggaagcgattcgc
ctgatcaaccaatggctgccgcaagccgtggacgacggacacaatcttgaagcccgcgag
caaatggcgtttggccagtatctggcgggcatggcgtttaacagcgccggtcttggcctg
gtgcatgcgctggctcatcagccgggcgctacccacaacctgccgcacggcgtgtgcaac
gccatcctgctgccgatcatcgaaaactttaatcgcccgaacgcggttgcccgcttcgcg
cgcgtggcgcaggcgatgggcgtcgatactcgcggtatgagcgatgaagcggccagcatg
gaggccatcaacgccatccgcgcgctaagcaaacgcgtcggcattccgcaaggcttcagc
cagcttggcgtcagcaaagccgatattgaaggctggctggataaagcgctggccgacccg
tgcgcaccgtgcaatccgcgcaccgccagccgcgatgaagtccgcgaactctatctggag
gcattatga

DBGET integrated database retrieval system