KEGG   Klebsiella oxytoca KONIH1: KONIH1_01530Help
Entry
KONIH1_01530      CDS       T03269                                 

Definition
(GenBank) sensor protein ZraS
  KO
K07709  two-component system, NtrC family, sensor histidine kinase HydH [EC:2.7.13.3]
Organism
kok  Klebsiella oxytoca KONIH1
Pathway
kok02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kok00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KONIH1_01530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kok01001]
    KONIH1_01530
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kok02022]
    KONIH1_01530
Enzymes [BR:kok01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     KONIH1_01530
Protein kinases [BR:kok01001]
 Histidine kinases
  NtrC family
   KONIH1_01530
Two-component system [BR:kok02022]
 NtrC family
  HydH-HydG (metal tolerance)
   KONIH1_01530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA sCache_3_2 HATPase_c_2 HATPase_c_5 HATPase_c_3 Diacid_rec
Motif
Other DBs
NCBI-ProteinID: AID87782
Position
306445..307833
Genome map
AA seq 462 aa AA seqDB search
MNAMRLSKDSVAVWLSWLLTGLILLLVCLFSALIVRDYGRENEAARQTIQEKGSVLIRAL
ESGARVGMGMRMHHSQLQALLEEMAWQPGVLWFAVTDESGKIIAHSDPRRVGESLYPAST
LRELNIGSEERWRRLEKPEPALEIYRQFRPLNGGGHHMRMMMRREAAGLRTQAPQVIFIA
FDTRELDADHARSLRNMVIMLCAAGVVMAATLLAQFWFRRYQRSRKQLQEATARKEKLVA
LGHLAAGVAHEIRNPLSSIKGLAKYFAERTPADGEAHQLAQVMAKEADRLNRVVSELLEL
VRPAHLTYQSVDLNDVITHSLQLISQDAASRAITLAFTAQPALCRIQADPDRLKQVLLNL
YLNAVHAIGRDGVITVAVRECGDGRVKVSVADSGKGMTAEQLQAIFTPYFTTKADGTGLG
LAVVQNIVEQHGGTIHAESAPGEGALFTLYLPVNGQQKDEQG
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgatgcggttgtctaaggattccgtcgccgtctggctgagctggttgttaacc
ggccttatcttgctgctggtgtgcctgttctctgcgttaatcgtgcgtgattatggccgt
gaaaatgaagccgcgcgccagactatccaggaaaaaggcagcgtgctgattcgcgccctt
gagtccggcgcccgggtgggcatgggaatgcgtatgcatcattcccaactgcaggcgttg
ctggaggagatggcctggcagcctggcgtgctgtggttcgctgtgacggatgagagcggt
aaaatcattgcccatagcgacccgcggcgggttggtgagtcgctctatcctgccagcact
ctgcgtgagctgaatattgggagcgaggagcgctggcgccggctcgaaaaaccggaaccg
gcgctggagatttatcgtcaatttcgcccgcttaacggcggcgggcatcatatgcgcatg
atgatgcgtcgcgaagctgccgggctacgtacccaggctccccaggttatttttattgct
tttgatacccgcgagctggatgccgaccatgcccgtagcctgcgtaatatggttatcatg
ctctgcgcggcgggcgtagtgatggcggcaacgttgctggcgcagttctggttccgccgc
tatcaacgttcgcgcaagcagctgcaggaggcgacggcgcgtaaagaaaagctggtggcg
cttggtcatctggccgcgggcgtcgcccatgagatccgcaacccgctgtcatctataaaa
gggctggcaaagtattttgccgagcgaaccccagccgatggcgaagcgcatcagctggcc
caggtgatggcgaaggaagccgatcgcctgaacagggtcgtcagcgagctgctggaactg
gtgcgtccggcgcatttaacgtatcaatcggttgatttgaatgacgtgattacgcactcg
cttcagctaattagccaggatgccgccagccgggcaataacgctcgcgttcaccgcgcag
cccgcgctatgccgcattcaggccgatccggatcgtttgaaacaggtgctgctgaacctt
tatctcaatgccgtccacgctattggccgcgatggcgtgattacggtggcggtgagggaa
tgcggcgacgggcgagtaaaggtgagcgttgcggacagcggcaaggggatgacggcggaa
cagctacaggccatttttactccgtacttcacgaccaaggccgacggcaccgggctgggc
ctggcggtggtgcagaacattgtcgagcagcacggtggaacgattcacgccgagagcgcc
cccggcgaaggcgcgctatttactctctatttgccggtcaacgggcaacaaaaggatgaa
caaggatga

DBGET integrated database retrieval system