KEGG   Klebsiella oxytoca KONIH1: KONIH1_13660Help
Entry
KONIH1_13660      CDS       T03269                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
kok  Klebsiella oxytoca KONIH1
Pathway
kok00010  Glycolysis / Gluconeogenesis
kok00071  Fatty acid degradation
kok00350  Tyrosine metabolism
kok00625  Chloroalkane and chloroalkene degradation
kok00626  Naphthalene degradation
kok00680  Methane metabolism
kok01100  Metabolic pathways
kok01110  Biosynthesis of secondary metabolites
kok01120  Microbial metabolism in diverse environments
kok01130  Biosynthesis of antibiotics
kok01200  Carbon metabolism
kok01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KONIH1_13660
  09102 Energy metabolism
   00680 Methane metabolism
    KONIH1_13660
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KONIH1_13660
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    KONIH1_13660
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KONIH1_13660
   00626 Naphthalene degradation
    KONIH1_13660
Enzymes [BR:kok01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KONIH1_13660
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     KONIH1_13660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Met_10 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AID90079
Position
2874639..2875757
Genome map
AA seq 372 aa AA seqDB search
MKSRAAVAFGPGQPLSIVEIDVAPPKKGEVLVKITHTGVCHTDAFTLSGDDPEGVFPAVL
GHEGGGIVVEVGEGVTRLQPGDHVIPLYTAECRECKFCKSGKTNLCQAVRATQGKGLMPD
GTTRFSYNGEPIYHYMGTSTFSEYTVVAEISLAKVNPQAPLDKVCLLGCGVTTGIGAVHN
TAKVKEGDTVAVFGLGGIGLAVIQGAVQAKAGRILAVDTNPEKFTLAKEMGATDFINPND
YDKPVQDVIVELTDGGVDFSFECIGNVNVMRAALECCHKGWGESVIIGVAGAGQEIKTRP
FQLVTGRVWRGSAFGGVKGRTQLPGMVEEAMAGKIRLDPFITHRMPLDQINEAFDLMHEG
KSIRTVIHFGEN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgtgcagccgtcgcgtttggcccaggccagccgctttcaatcgttgagatt
gacgtcgcgccgccgaaaaaaggcgaagtgctggtcaaaatcacccataccggcgtatgc
cacaccgatgcctttaccctctcaggcgacgatccggaaggcgttttcccggcggtactg
ggccatgaaggcggcgggattgtcgtcgaagtgggggaaggcgtgaccagactgcagccg
ggtgaccacgttattcctctgtataccgccgaatgccgcgagtgtaagttctgtaaatcc
ggcaaaactaacctctgccaggcggtgcgcgccactcagggtaaaggcctgatgccggac
ggcaccacccgtttctcctacaacggtgaaccgatttatcactatatggggaccagcacc
ttcagcgaatacaccgtagtggccgaaatttcgctggcaaaagttaacccgcaggcgccg
ctggataaagtctgcctgctgggctgcggcgtcactaccggtatcggcgcggtgcacaat
acggcgaaagtaaaagagggcgataccgtcgccgtcttcggcctcggcgggatcggcctg
gcggtgatccagggcgcggtacaggcgaaagccgggcgcattctggcggtggataccaac
ccggaaaaattcactctcgcgaaagagatgggcgcgaccgactttatcaacccgaatgat
tacgataagccggttcaggatgtgattgttgaactcaccgacggcggcgtcgactttagc
ttcgagtgtatcggtaacgtcaacgtgatgcgcgcggcgctggagtgctgccacaaaggc
tggggcgaaagcgtcatcatcggcgttgccggcgcgggccaggagattaaaacccgccca
ttccagctggtcaccgggcgcgtctggcgcggctccgcgttcggcggcgtgaaagggcgt
acccaactgccgggaatggttgaagaggcgatggcggggaaaattcgcctcgatccgttt
attacccaccgtatgccgctggatcaaatcaacgaagcgtttgatctgatgcatgaaggt
aaatccattcgtaccgtcattcatttcggcgagaattga

DBGET integrated database retrieval system