KEGG   Klebsiella oxytoca KONIH1: KONIH1_15305Help
Entry
KONIH1_15305      CDS       T03269                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
kok  Klebsiella oxytoca KONIH1
Pathway
kok00250  Alanine, aspartate and glutamate metabolism
kok00650  Butanoate metabolism
kok00760  Nicotinate and nicotinamide metabolism
kok01100  Metabolic pathways
kok01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KONIH1_15305
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KONIH1_15305
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KONIH1_15305
Enzymes [BR:kok01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     KONIH1_15305
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     KONIH1_15305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh baeRF_family2
Motif
Other DBs
NCBI-ProteinID: AID90390
Position
complement(3226830..3228215)
Genome map
AA seq 461 aa AA seqDB search
MNLSATHAISVSPTTGETLSSVPWASEQQVDAAIALAEQGYRQWRNVSVAERAATLRNVG
SAMRARGEALAQMISREMGKPIAQARGEVAKSANLCDWYAEHGPAMLNTEATLVEDNKAV
IEYRPMGAILAVMPWNFPVWQVLRGAVPILLAGNSYLLKHAPNVLGSAAMIGEIFAAAGV
PDGVFGWVNATNDGVSQMINDPRIAAVTVTGSVRAGKAIGAQAGAALKKCVLELGGSDPF
IVLKDADLDEAVKAAVIGRYQNTGQVCAAAKRFIVEAGIAEAFTQKFVAAAAALKMGDPR
DEQNYIGPMARFDLRDELHEQVRATLKEGATLLLGAEKIEGAGNYYAPTVLGNVTAEMTG
FREELFGPVATITEARDADHALALANDSEFGLSATVYTTSEAQAQRFADELECGGVFING
YCASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWRDRR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatctgctactcatgcgatttccgtgagtccgaccaccggtgaaactttgtcg
tctgtgccctgggccagcgaacagcaggtcgatgcggccattgcccttgcggaacagggg
tatcgtcagtggcgcaacgtcagcgtggcggagcgcgctgcgacgctgcgtaacgtcggt
agcgcgatgcgcgcccgtggcgaagcgctggcgcaaatgattagccgcgaaatgggtaaa
ccgattgcccaggcgcgcggcgaagtggctaaatccgccaatctttgtgactggtatgct
gaacacggcccggcgatgctcaataccgaggcgacgctggttgaagacaataaagcggtg
attgagtaccgcccgatgggggctatcctcgctgtcatgccgtggaacttcccggtgtgg
caggtgctgcgcggcgcggtgcccattctgctggcgggcaacagctatctgcttaagcat
gcgccaaacgtgctgggcagcgcggcgatgatcggcgaaatttttgccgctgcgggcgtg
ccggacggcgtctttggctgggtgaacgccaccaacgatggcgtttcgcaaatgattaac
gatccgcgcatcgccgcggtaaccgtcaccggcagcgtgcgcgccgggaaggccattggc
gcacaggccggcgcggcgttgaaaaaatgcgtgctggagctgggcggctccgatcccttt
atcgtgcttaaagatgccgaccttgacgaggcggtgaaagcggcggtgataggtcgctac
cagaataccggtcaggtctgcgccgcggcgaagcgttttatcgtcgaagcgggcatcgcc
gaggcctttacgcagaaatttgtcgccgccgctgccgcgctgaaaatgggcgacccgcgc
gatgagcagaactatattgggccgatggcgcggttcgatctgcgcgatgagctgcacgag
caggtgcgcgcgaccttaaaagagggggcgaccctgctgctgggggcggaaaaaatcgaa
ggcgccggcaactactacgcgccgacggtgctcggaaacgttaccgcggagatgaccggt
ttccgcgaggagctgtttggcccggtggcgacgattaccgaagcccgcgatgccgatcac
gcgctggcgctggctaatgatagcgaatttggcctttcagcaacagtttacaccaccagt
gaagcgcaggcccagcgttttgccgatgagctggagtgcggcggagtgtttatcaacggc
tactgtgccagcgatgcccgcgtggcgttcggcggcgtgaagaaaagcggatttggccgc
gagctctcccattttggtctgcatgaattctgcaacgtgcagaccgtctggagagatcgc
cgctag

DBGET integrated database retrieval system