KEGG   Klebsiella oxytoca KONIH1: KONIH1_24460Help
Entry
KONIH1_24460      CDS       T03269                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kok  Klebsiella oxytoca KONIH1
Pathway
kok00071  Fatty acid degradation
kok00280  Valine, leucine and isoleucine degradation
kok00310  Lysine degradation
kok00362  Benzoate degradation
kok00380  Tryptophan metabolism
kok00620  Pyruvate metabolism
kok00630  Glyoxylate and dicarboxylate metabolism
kok00640  Propanoate metabolism
kok00650  Butanoate metabolism
kok00900  Terpenoid backbone biosynthesis
kok01100  Metabolic pathways
kok01110  Biosynthesis of secondary metabolites
kok01120  Microbial metabolism in diverse environments
kok01130  Biosynthesis of antibiotics
kok01200  Carbon metabolism
kok01212  Fatty acid metabolism
kok02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KONIH1_24460
   00630 Glyoxylate and dicarboxylate metabolism
    KONIH1_24460
   00640 Propanoate metabolism
    KONIH1_24460
   00650 Butanoate metabolism
    KONIH1_24460
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KONIH1_24460
   00072 Synthesis and degradation of ketone bodies
    KONIH1_24460
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KONIH1_24460
   00310 Lysine degradation
    KONIH1_24460
   00380 Tryptophan metabolism
    KONIH1_24460
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KONIH1_24460
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KONIH1_24460
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KONIH1_24460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kok04147]
    KONIH1_24460
Enzymes [BR:kok01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KONIH1_24460
Exosome [BR:kok04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KONIH1_24460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III HemY_N
Motif
Other DBs
NCBI-ProteinID: AID92128
Position
5123978..5125168
Genome map
AA seq 396 aa AA seqDB search
MTQANDIVVVSGVRTAIGTFNGSLKHTHQHDLGAAVIREAIARAGLAPQDIDETIVGNVG
QIAESGFIARICQLRAGIPQESTAYSVNRQCGSGLQALADGMMQLQSGQAEVVVACGTEN
MTQLPYYLRKARDGYRMGHGELEDGLISILTWPEGPYHNGITAENVAQRFGITREAMDDF
AWSSQQKALKAIAEDRFREQILALEVPDGKKATRLFATDEHPRDTPREKLAALRPAFKAD
GVVTAANSSGINDGAAALVMMTRQQAEQRGLTPRMRIRGWAVAGCGAEIMGFGPSPATRR
LMDRLNMDVHAIDLIELNEAFAAQALAVMNDLRLDPARVNVNGGAIALGHPVGASGAILP
VKLMYEMARSGARTGLVTMCIGGGQGISMLFEREGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggctaatgatattgtggttgtcagcggcgttcgtaccgctattggcacgttt
aacggcagtcttaagcatacccaccagcacgatctcggggcagcggttattcgcgaagcg
atcgcccgcgccgggcttgcgccgcaggatatcgatgaaacgatcgtcggcaacgtcggg
caaatcgccgaaagcggttttatcgcccgcatctgccagctgcgggcggggatcccgcag
gagagcaccgcgtattcggttaaccgccagtgcggctccgggcttcaggccctggcggac
ggcatgatgcagctgcaaagcggccaggccgaggtggtcgtcgcctgcggaacggaaaat
atgacccagctgccctactacctgcgcaaagcgcgcgatggctatcgcatgggccacggc
gagctggaagatggactgatctccatccttacctggccagaagggccttatcacaacggc
atcacggcggaaaacgtcgcgcaacgcttcggtattacccgcgaagcgatggacgatttc
gcctggtcgagccagcagaaggcgctgaaggcgatcgctgaggatcgcttccgcgagcag
attctggcccttgaggtaccggacggcaaaaaagcgacccgcctgttcgcgaccgatgaa
cacccgcgcgacaccccgcgcgaaaagctcgccgcgctgcgtccggcatttaaagccgac
ggcgtggtgacggcggccaactcctccggcattaacgacggcgcggccgcgctggtgatg
atgacccgccagcaggcggaacagcgcggcttaaccccgcgcatgcggattcgcggctgg
gcggtcgccggctgcggcgcggagattatggggtttggcccctctcccgctacccgacgc
ctgatggaccgtctcaatatggatgttcacgccatcgatttaattgaactcaatgaggcc
ttcgccgcccaggcgctggcggtgatgaacgatctgcgtctcgatccagcccgcgttaac
gtcaacggcggcgcgatcgccctcggccacccggtgggcgccagcggtgcgatcctgccg
gtcaaactgatgtatgaaatggcgcgcagcggcgcacgcaccggtctggtcaccatgtgc
attggcggcggccaggggatttctatgctgttcgagcgcgaaggcgcttag

DBGET integrated database retrieval system