KEGG   Kosmotoga olearia: Kole_0359
Entry
Kole_0359         CDS       T00914                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
kol  Kosmotoga olearia
Pathway
kol00472  D-Arginine and D-ornithine metabolism
kol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kol00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Kole_0359
Enzymes [BR:kol01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Kole_0359
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: ACR79084
UniProt: C5CDK0
Position
377920..378291
AA seq 123 aa
MVQRADDFKERSKRLQNMTDEELDRYFWELAEKIVDPLIKLASTHTSPSIERSVLLRMGF
NSLEAKAIVEKVVDMGLLGKGAGNIVYTISQKTGKSILEAGRELAAGKYWDLVEESFKGV
GSK
NT seq 372 nt   +upstreamnt  +downstreamnt
atggtacagagagctgatgattttaaggaaagaagtaagcgtcttcagaatatgaccgat
gaagaattggacaggtatttctgggaactcgctgaaaaaattgttgatcctttgatcaag
ctcgccagtactcacactagtccatcaattgagcgctcggttctattgagaatgggtttc
aatagtttagaagccaaagcaatagtcgaaaaagttgttgatatgggattactgggaaaa
ggtgctggtaatatcgtttacaccatttctcaaaaaacaggaaaatccattctcgaagct
ggaagagagctcgcagccggtaagtactgggaccttgttgaagagagtttcaaaggggtg
ggatcaaaatga

DBGET integrated database retrieval system