KEGG   Kosmotoga olearia: Kole_0360
Entry
Kole_0360         CDS       T00914                                 

Definition
(GenBank) D-Lysine 56-aminomutase alpha subunit
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
kol  Kosmotoga olearia
Pathway
kol00472  D-Arginine and D-ornithine metabolism
kol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kol00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Kole_0360
Enzymes [BR:kol01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Kole_0360
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: ACR79085
UniProt: C5CDK1
Position
378288..380483
AA seq 731 aa
MSLPPNERLNVEEILKDLEHYRPRRRGWTWRKKLPEGTKIGEFTYDQISEPLKNSVPLPA
AHHFGNIDPQPDVVITSEIASGRFEDDIRRMRMAAWHGADHIMVIRTLGQSHMDGLIEGT
PEGIGGVPITRKQIRASRKALDIIEDEVGRPINFHSYVSGVAGPEIAVLFAEEGVNGAHQ
DPQYNVLYRGINPIRSFVDAAVAKKIMAWANMLQIDGAHNANASAKMAWKVMPELIVQHA
INCMFSLKAGMKKENIALSTVPPMVSPAPEFKLNFIYALTVRELFKGFRFRAQMNTRYIE
SDLFDATRIHVLDTLISRLTSADLQSTITPDEGRNVPWHINSVRGVETAKHTLIALDGIK
KFLKVNEEEVRPRIRELKMRAILFMEEILEIGGYFEAVEQGFFVDNGYYPERMGDGIARP
KDGGIGAGSVVPRDPDYMAPVCEHFGYNNLPEGIEKPCDLIGGCTFHNPEKIQFIDELDE
NDNVTNRIQKVIEEREKGFIGPEVEWWGDGWIQIDMTIPDDEAHAEAAAIEICKRLGLEE
PTVISKTILHPVEGTYIELKARVPFKVNRNELELPKKPETLPEEEIFQYVSKHPIKVVAG
TAGNDEHSVGLREILDIKHGGIEKYGIKYTYLGTSVPPEKFIDAAIETGADAILVSLIIT
HNDVHVQNMKKIHQLAIEKGIRDKIILIAGGTQINNDLAVSCGMDGGFGRGTKGIHVASF
LVKKLREKHSN
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgagtttaccaccaaatgaaagattgaatgttgaagagatccttaaagatttagaacat
tacagaccgcgaagaagaggctggacgtggagaaaaaaacttccagaaggtacaaaaata
ggggaatttacttatgatcaaataagtgaacctttgaaaaatagcgttcccctaccagct
gctcatcattttggaaatatcgatcctcaacccgatgtggtcataacctccgagatcgct
tccgggaggttcgaagatgatattcgcaggatgagaatggcggcgtggcatggtgccgat
catatcatggtcatacgtacgcttggccagagccatatggatggtctcatagaaggtaca
cctgaaggtattggaggtgtacctattaccagaaaacagatacgggccagcagaaaggca
ctggatataattgaagacgaagttgggcgtccaataaactttcacagctacgttagtggt
gttgcaggacctgaaatcgctgtgctttttgccgaagaaggtgtgaacggtgcgcatcag
gatccccaatataatgtactttacagaggaataaacccgataagatcctttgtggatgct
gcggttgcgaaaaaaataatggcatgggcaaatatgctgcagattgacggggctcacaac
gcgaacgcctccgccaaaatggcctggaaagtgatgccggaacttatcgttcaacatgcg
ataaactgtatgttctctttaaaagcaggcatgaagaaagaaaacattgctctttcaacc
gttccaccaatggtttctccagcccccgaatttaagctgaacttcatttatgctcttaca
gtgagagaattgttcaaaggattccgtttcagagctcaaatgaataccagatacatcgag
tccgacctctttgatgctacaagaatacacgttctcgatacccttatctccaggttgacc
agtgcagatttgcaatccactatcactccagatgaaggaagaaatgtgccgtggcatatt
aattccgtaagaggtgttgagacagcaaaacacacgcttatagctctcgatggaataaaa
aaattcctgaaggtcaatgaggaagaagttagacccagaataagggaactaaaaatgcgt
gccatactctttatggaggaaatactggaaataggaggatattttgaagcggtagaacag
ggcttttttgttgataacgggtactacccagaaagaatgggtgatggaatagcgagacct
aaagatggtggaataggagccggtagtgttgttccgagagatcctgattacatggctcct
gtttgtgaacatttcggttataacaacctccccgaaggtatagaaaaaccatgtgatctc
atcggtggttgtactttccataaccctgaaaaaatacagtttatcgatgaactggacgaa
aacgataacgttactaacagaattcagaaggtgatagaagaaagagaaaagggcttcatt
ggtccagaagtagagtggtggggtgatggctggatacagatagacatgactattcctgat
gacgaagctcacgcagaagccgctgcaattgaaatttgtaaacgtttggggttggaagaa
cccacagtgataagcaaaacaatccttcatccggtggagggaacctatatcgaattgaaa
gcgcgtgttccatttaaagtgaaccgaaatgaactcgagcttccaaaaaaacccgaaacc
ctcccggaagaggaaatattccaatatgtttccaaacacccaataaaggtcgtcgctggc
accgcaggcaatgatgagcactcagtaggtttaagggagattttagacataaaacatggt
ggaatagaaaaatatgggatcaagtacacttacctcggtaccagcgttccaccggagaaa
ttcatagacgctgcaatagagacgggtgctgatgctatccttgtttctttaataatcact
cacaacgatgtgcacgtacaaaacatgaaaaagattcatcaactcgccatcgaaaaagga
atcagggataaaataattctcatagccgggggaacgcagataaacaacgatcttgctgtt
agctgtggtatggacggcggatttggtcgtggcaccaaaggcattcacgttgcgagtttc
cttgtaaaaaaactcagggaaaagcactctaattaa

DBGET integrated database retrieval system