KEGG   Kosmotoga olearia: Kole_0381Help
Entry
Kole_0381         CDS       T00914                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
kol  Kosmotoga olearia
Pathway
kol00010  Glycolysis / Gluconeogenesis
kol00020  Citrate cycle (TCA cycle)
kol00620  Pyruvate metabolism
kol00640  Propanoate metabolism
kol00650  Butanoate metabolism
kol00680  Methane metabolism
kol01100  Metabolic pathways
kol01120  Microbial metabolism in diverse environments
kol01130  Biosynthesis of antibiotics
kol01200  Carbon metabolism
Module
kol_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kole_0381
   00020 Citrate cycle (TCA cycle)
    Kole_0381
   00620 Pyruvate metabolism
    Kole_0381
   00640 Propanoate metabolism
    Kole_0381
   00650 Butanoate metabolism
    Kole_0381
  Energy metabolism
   00680 Methane metabolism
    Kole_0381
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Kole_0381
Enzymes [BR:kol01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Kole_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ACR79106
UniProt: C5CDT7
Position
398097..399266
Genome map
AA seq 389 aa AA seqDB search
MPVKKAITGAAAVANAMRQINPDVVAAYPITPQTPIVEYFAKFVADGIVDTETIPVESEH
SAMSAVVGAAAAGARAMTATSANGLALMHEIVYIAASSRLPIVMPVVNRALSGPINIHCD
HSDTMAERDSGWIQLFCENAQEAYDLTLIALKLAERKEVRLPVMVNQDGFIISHGVEVVE
LLDDDVVKEFIGESTPMYSLLDIDHPVTYGPLDLYDYYFEHKRQQVEAMENAYKIFPEIA
EAFEKISGRKYWYVEPYKVDDADYVMVALGSTNGSIKYVVDELREQGKNVGLLKITMFRP
FPKEFIRKYLDGKKGVIVLDRSLSFGAEAPLYSEIKSILYEANSRPAIGSYVYGLGGRDI
TPAMIKQAFEDALSGNLNSDEQRYLGLRE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgccagttaaaaaagcgattaccggagctgcggcggttgcaaatgccatgaggcaaata
aatcctgatgttgtcgctgcttatccaataactcctcaaacacctatcgttgaatatttt
gcgaaattcgttgccgatggtattgtcgatacagaaacaattcctgttgaaagcgaacac
agcgcgatgagtgccgttgtcggtgctgctgccgctggtgcgagagctatgaccgccacc
agcgctaacggtcttgcactgatgcacgaaatagtttacatagctgccagttcaagactt
ccaatcgttatgccagtcgtcaacagagctctcagtggaccgataaatatccactgtgac
cacagtgataccatggcagagagagattccggctggattcagctgttctgtgaaaacgct
caggaagcttatgaccttacccttatcgctctcaaactagctgagagaaaagaagttagg
cttccagttatggttaaccaggatggctttattatctcccacggcgtggaagtcgtagag
cttcttgacgatgacgtggttaaggaatttatcggagaatccactccgatgtactctctt
cttgacatagatcaccctgtcacttacgggccacttgacctctacgattattacttcgaa
cataaacgccaacaggtagaagctatggaaaatgcttataaaatcttcccggaaatcgcc
gaagcatttgagaagatttccggtaggaaatactggtatgttgaaccttacaaagttgat
gacgctgattatgtaatggttgctctcggctcaacaaatggaagcatcaaatacgttgta
gatgaattgagagaacaggggaagaacgttggtcttttgaaaatcaccatgttcagaccc
ttcccgaaagaatttataagaaaatatcttgacggtaagaaaggtgttatcgttcttgat
cgttcactgagtttcggcgcggaagcacctctctactccgagatcaaatctatcctgtac
gaggctaactccaggcctgctatcggctcttatgtctatggtctcggtggaagggacata
acacccgcaatgataaaacaggcttttgaagatgcactcagtggtaatctcaacagcgac
gaacaacgttacctcggcttgagagagtga

DBGET integrated database retrieval system