KEGG   Kosmotoga olearia: Kole_0382Help
Entry
Kole_0382         CDS       T00914                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
kol  Kosmotoga olearia
Pathway
kol00010  Glycolysis / Gluconeogenesis
kol00020  Citrate cycle (TCA cycle)
kol00620  Pyruvate metabolism
kol00640  Propanoate metabolism
kol00650  Butanoate metabolism
kol00680  Methane metabolism
kol01100  Metabolic pathways
kol01120  Microbial metabolism in diverse environments
kol01130  Biosynthesis of antibiotics
kol01200  Carbon metabolism
Module
kol_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kole_0382
   00020 Citrate cycle (TCA cycle)
    Kole_0382
   00620 Pyruvate metabolism
    Kole_0382
   00640 Propanoate metabolism
    Kole_0382
   00650 Butanoate metabolism
    Kole_0382
  Energy metabolism
   00680 Methane metabolism
    Kole_0382
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Kole_0382
Enzymes [BR:kol01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Kole_0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C zf-NADH-PPase
Motif
Other DBs
NCBI-ProteinID: ACR79107
UniProt: C5CDT8
Position
399284..400258
Genome map
AA seq 324 aa AA seqDB search
MAINVIQLAKEFAKKDIGITQGHRLCPGCGAPNTAKMALMVAKHLGYEPVVGFATGCMEV
STTIYPYSAWSVPYIHNAFENVGATISGAETAYRALKKKGKLPTDKPIKFFAFAGDGGTY
DIGLQSLSGAIERGHDFVYILYDNEGYMNTGNQRSGSTPPGSQTTTAPVGEKIPGKLQLK
KNIVEIVAGHENVYAATAAIGEPIDYMNKLQKAIEFDGPAFIAVMAPCVRFWRIKEDSAP
AISKLAVETLYWPLYEYERGIYRITRKPRNIKPVEEFLKAQQRFRALLNHPDRDKIIDML
QNYVTKKWERLLALEEATKDKPLR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggctattaatgtgatacagcttgcaaaggaattcgccaaaaaggatatcggtataact
cagggtcatcgtctttgtccaggatgcggcgcacctaacacggcaaagatggccttgatg
gttgccaagcacctcgggtacgaacccgttgtgggttttgccacaggttgtatggaagtt
tctaccacaatctacccatattccgcatggagtgttccatacatccacaacgcttttgaa
aacgttggggctaccataagcggtgctgagacagcatatagagcactcaaaaagaagggt
aagcttccaacggataaaccaataaagttcttcgcttttgcaggagatggcggaacctac
gatatagggcttcagtctctttcaggtgcaattgaaagaggtcatgatttcgtttacatc
ctttatgacaatgaaggatatatgaacactggaaaccagagaagtggttccacacctcct
ggaagccaaacaacaacggcgcccgttggagaaaaaatacccggaaagctgcagctcaaa
aagaatattgtagaaattgttgcggggcatgaaaatgtttacgccgccacagctgctatc
ggcgaacccattgattacatgaacaagctccagaaagccatcgaattcgacgggcccgct
tttatagctgttatggctccatgtgtcagattttggagaattaaagaagattctgctccg
gctatctcaaaacttgctgtcgaaaccctgtactggccgttgtacgaatacgaaagagga
atctacagaataaccagaaaaccgagaaatataaaaccggtagaagaattcctgaaggca
caacagaggttcagagcccttctcaatcatcctgatagagataaaataatcgatatgctc
cagaattatgtcaccaagaaatgggaaaggctcctcgctctggaagaagctacaaaggat
aaaccacttcgttaa

DBGET integrated database retrieval system