KEGG   Kosmotoga olearia: Kole_1014Help
Entry
Kole_1014         CDS       T00914                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
kol  Kosmotoga olearia
Pathway
kol00010  Glycolysis / Gluconeogenesis
kol00030  Pentose phosphate pathway
kol00051  Fructose and mannose metabolism
kol00052  Galactose metabolism
kol00680  Methane metabolism
kol01100  Metabolic pathways
kol01110  Biosynthesis of secondary metabolites
kol01120  Microbial metabolism in diverse environments
kol01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kole_1014
   00030 Pentose phosphate pathway
    Kole_1014
   00051 Fructose and mannose metabolism
    Kole_1014
   00052 Galactose metabolism
    Kole_1014
  Energy metabolism
   00680 Methane metabolism
    Kole_1014
Enzymes [BR:kol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Kole_1014
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Kole_1014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACR79721
UniProt: C5CHG6
Position
1074120..1075349
Genome map
AA seq 409 aa AA seqDB search
MKKRNLIYGQSGGVTSVINASAYGAIIAAINNPMVENVYAALNGIKGILEERIIDLKAES
KDEIEKIAFTPGAIFGSCRTKLKTEEDFERLFKVFDAYDIGYFLYNGGNDSMETAYQIAL
KAQEYGYPLKVIGIPKTVDNDLMYTDHCPGYGSAAKFTAISILEATRDLESMHTDSTQVF
ILESMGRYAGWLAASGILASINGERGPQIFLLPEVPFNEEKFLSKVEEVIRRDGYCSIVA
AEALKDSEGNYISTEDYTDAFGNIQLGKIGIYLQKLIRQNLGRKVHTALPDYLQRSSRHI
ASLTDWEEAIGVGAAAVKFAVDQGLSGVMVSIVRDLDSPYLKHYEPVSLEGIGGKVKYLP
EEYISPDGFGVTEKFVEYVRPLIQGEAPNHYLRGIPVYANLKKVPVKRK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagaaatctaatatatggccaatctggcggagtgacatctgtgataaacgct
tcagcatacggtgctataattgcagccatcaacaaccctatggttgagaatgtttacgct
gctctgaacgggataaagggaatactggaagaaagaataatcgatttgaaagccgaatca
aaggatgagattgaaaagattgcttttactcctggagcaatctttggctcttgcaggaca
aagctcaaaactgaagaagatttcgagcggttgttcaaagtctttgacgcatacgatata
ggttattttctatacaatggcgggaacgactctatggaaaccgcttatcaaatagcgtta
aaagcacaggaatacggctatccgctgaaagtaataggaatccccaagactgttgataat
gaccttatgtatactgaccattgtcccggttatggctccgcagcaaaatttacagccata
tcaattcttgaagctacaagagatctggagtcaatgcataccgactcgactcaggttttc
atactagaatccatgggacgctatgccggttggcttgctgcttcagggattcttgcaagt
ataaatggagaacgcggccctcaaatctttcttctaccggaggtacccttcaatgaagag
aaatttctgtcgaaagttgaggaagtcataagaagagacggatattgcagcattgttgct
gctgaagctttaaaagactctgaaggaaattacatttcgacagaagattataccgacgca
tttggcaatatccagcttggaaagataggtatttacctgcaaaagttgatacgacaaaat
ctcggcagaaaggttcatacagctcttccggattatctccagcggtcttctagacacata
gccagcttgacagattgggaggaagccatcggagttggagctgctgcggttaaatttgcg
gttgatcaaggactaagtggtgttatggtgtcgatagtaagagatttagatagtccatac
ttgaagcactatgagcctgtcagtttagaagggataggtggaaaggttaagtatctgcca
gaagagtatatctccccggatggttttggtgtcaccgaaaagttcgtcgaatacgtaaga
cctttgatacagggcgaagctcccaaccattaccttcgagggataccggtatatgcaaat
ctgaaaaaagttccagtaaaaagaaaataa

DBGET integrated database retrieval system