KEGG   Kosmotoga olearia: Kole_1524Help
Entry
Kole_1524         CDS       T00914                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
kol  Kosmotoga olearia
Pathway
kol00010  Glycolysis / Gluconeogenesis
kol00071  Fatty acid degradation
kol00350  Tyrosine metabolism
kol00625  Chloroalkane and chloroalkene degradation
kol00626  Naphthalene degradation
kol01100  Metabolic pathways
kol01110  Biosynthesis of secondary metabolites
kol01120  Microbial metabolism in diverse environments
kol01130  Biosynthesis of antibiotics
kol01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kole_1524
  Lipid metabolism
   00071 Fatty acid degradation
    Kole_1524
  Amino acid metabolism
   00350 Tyrosine metabolism
    Kole_1524
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Kole_1524
   00626 Naphthalene degradation
    Kole_1524
Enzymes [BR:kol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Kole_1524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Proteasome
Motif
Other DBs
NCBI-ProteinID: ACR80214
UniProt: C5CEN4
Position
complement(1635746..1636861)
Genome map
AA seq 371 aa AA seqDB search
MWHYYLPTHVFFGETVVEKHGKVVQECGAKALIVTGRRSARLSGALHDIIKVLTELKIPY
IHFDRVEENPSFETVRKGTELLRKENCDFVIAIGGGSPLDAGKAMAIMGTDPDLKVEDLY
DRESYLFSLPVVAIPTTSGTGSEVTQYSVLTDDEGNKKGFATPHAFPMYSFLDPRYTITM
TEETTIATALDALSHSIEGELLNNAVNPIVKNHSRVTNELIKNNLKNATITPEDIPVRSL
LQYAAMLAGIVIAHTGTTVVHAAGYPLSSKRGIKHGIANAVFLVEVLRKVEESDPDRVKN
AIDPFESLNELEAFLNSFGVNEYKIELSDDELESWAEKAARAPHNARTPGEFDVEFYRNL
YKKVRKCQNTE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtggcattattatttaccaacacatgtttttttcggtgaaacagttgttgagaaacat
ggaaaagtggtgcaggaatgcggagcaaaagctctcatagttaccggaaggcgttctgca
aggttatcaggagcgttgcacgacattataaaggttttgactgaattgaagatcccttac
atacattttgatagggtggaagaaaacccgtcctttgaaacggtgagaaagggcaccgaa
cttctgagaaaagaaaattgtgattttgtcatcgccattggtggcggaagcccattagat
gccgggaaagctatggccataatgggtaccgatcctgatcttaaagtggaagatctttac
gatcgcgagagttatcttttctcactgcctgttgtcgcaatccctacaacctctggtaca
ggaagtgaagtcacccagtattctgttctaacggacgacgaaggcaataagaaaggcttt
gccacacctcatgccttcccgatgtattccttcctcgacccccgctacacgataacaatg
accgaagaaactaccatagctaccgctctagatgccctgtcccattctattgaaggcgaa
ctgttgaacaacgccgttaaccctatcgttaaaaaccattccagggtcacaaatgaactc
atcaaaaacaatctgaaaaatgcaacaatcaccccggaagatatccctgtaaggtcttta
ttgcaatatgccgcgatgcttgcaggaatagtaatagctcacacagggacaacagtggtt
cacgccgcaggataccctttatccagtaaaagagggataaaacacggcatagcgaatgcc
gtttttctggtagaagtgcttcgaaaagtcgaagaatcagatccggatagagtcaaaaat
gccattgacccctttgagtcgctgaacgaactcgaagctttcttgaactctttcggggta
aacgaatataagatagaactctcagacgatgaactggaaagctgggcggaaaaagctgcc
agagctccacacaatgcaagaaccccgggtgagttcgatgtcgagttttatagaaacctc
tataaaaaggtgagaaagtgccagaatacagagtaa

DBGET integrated database retrieval system