KEGG   Kosmotoga olearia: Kole_1618Help
Entry
Kole_1618         CDS       T00914                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
kol  Kosmotoga olearia
Brite
Enzymes [BR:kol01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Kole_1618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Abhydrolase_5 PGAP1 Abhydrolase_4 Abhydrolase_2 BAAT_C Glyco_trans_4_5 Ser_hydrolase Abhydrolase_3
Motif
Other DBs
NCBI-ProteinID: ACR80308
UniProt: C5CF43
Position
1737109..1737861
Genome map
AA seq 250 aa AA seqDB search
MFNFSRTPKVMKGAESIHLEGNDNAVLLIHGFTGSPFELKELAHCLNESGYSVDVPRLPG
HGTVIEDMLTTRYQDWLRKVVDAYIDLKSKYKKVFVGGLSMGGTLTLALAEIFGDIDGIF
PLAAPIKLNRMDLKLTWLMKYFVKTRPKDPKGNVETVSYDADPIPQAWEMNKLMAMVRKN
LRRVTAPCLVVYSKKDGTVPYSNAELVYHGISSEKRKLVSLEESGHIITMDVEKEKVSSS
VMEFIRKIEK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatttttcgagaactccgaaagtaatgaaaggtgcggaaagtatccatctggaa
ggcaatgataacgctgttctcttgattcatggttttacaggaagcccttttgagctcaaa
gaacttgctcattgtttgaacgaaagcggttactccgtggatgtcccaaggctgcccggt
catggtacggttattgaagatatgctaacaacaaggtatcaggattggctgagaaaggta
gtcgatgcgtacattgatttgaaatcgaagtacaaaaaagtttttgtgggcgggctctcc
atgggtggaacgcttacattggcgttagctgagatatttggtgatatcgatgggatattc
cctctggctgcccctataaaactgaacagaatggacttaaaactaacgtggttaatgaag
tattttgtcaaaactcggccaaaagacccaaagggcaacgttgaaactgtttcgtatgat
gccgatcctatacctcaggcgtgggaaatgaacaaacttatggcaatggttagaaagaat
ttgagaagggtgacagccccctgtctcgtggtttattctaaaaaagatggaaccgtaccg
tatagcaatgcagagcttgtataccacggtatttcatcggagaagaggaagcttgtgtcc
cttgaagaaagtggtcatataattaccatggatgtagaaaaagaaaaggtttcgtcgtct
gtgatggaattcataagaaaaatagaaaaataa

DBGET integrated database retrieval system