KEGG   Kosmotoga olearia: Kole_1651Help
Entry
Kole_1651         CDS       T00914                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
kol  Kosmotoga olearia
Pathway
kol00430  Taurine and hypotaurine metabolism
kol00620  Pyruvate metabolism
kol00640  Propanoate metabolism
kol00680  Methane metabolism
kol01100  Metabolic pathways
kol01120  Microbial metabolism in diverse environments
kol01200  Carbon metabolism
Module
kol_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:kol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Kole_1651
   00640 Propanoate metabolism
    Kole_1651
  09102 Energy metabolism
   00680 Methane metabolism
    Kole_1651
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Kole_1651
Enzymes [BR:kol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Kole_1651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK
Motif
Other DBs
NCBI-ProteinID: ACR80340
UniProt: C5CFD1
Position
complement(1778916..1780139)
Genome map
AA seq 407 aa AA seqDB search
MKILVVNCGSSSIKYQLLDMKNELVLAKGIVERIGIDGSRLKHKKGKEKITIEKVISNHK
EGLDLVIKTLTDKETGVIENINEIDAVGHRVVHGGELFASSVLIDDRVIKEIEANAFLAP
LHNPPNIQGIKAAMELLPDVPHVAVFDTAFHQSMPEKAYLYAIPKEYYRKYKIRRYGFHG
TSHRYVAARVAEILGKPLNELKIITAHIGNGASIAAIDRGRSVDTSMGFTPLEGLVMGTR
SGDIDPAIVVFLQEQEGLTPKEINDLLNKKSGMLGLTDGKYSDMREIEEGAIANDPVCKL
AHDIYEYRIAKYIGAYTAAMNGVDAIAFTAGVGENSPYLRENVVKKYLGYLGITLDEKAN
DCKSCEKIISTPDSKVKVLIVPTNEELVIARDTKEIVEKGIKELKLW
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattctcgttgttaactgcggatcctcatcaataaagtaccagctgctcgatatg
aagaacgaattagttctggcaaagggcatcgttgaaagaatcggaatcgatggttcaagg
ctcaaacacaaaaaagggaaagaaaagatcaccattgaaaaagtaatctccaatcacaaa
gaagggctcgatctcgttattaaaacacttacagacaaagaaacaggtgttattgaaaat
atcaatgaaatcgatgccgtcggtcacagggtggtccatggtggagaattattcgcttcc
tctgttttgatagatgacagggtaatcaaagagatcgaagcgaacgcttttcttgctcct
cttcacaacccaccaaacattcagggtataaaagcggccatggaattattgccagatgtc
cctcatgtagcggtatttgacacagcctttcaccagtcaatgccggaaaaagcttatcta
tacgctatcccgaaagaatactatcgaaagtacaagatcagaaggtacggatttcacggt
accagccacagatatgtagctgcaagagtagcagaaatcctcgggaaacccttaaatgaa
ttaaaaataataaccgctcatatcgggaacggagcttcaattgccgcaatagatcgcggt
cgttctgtcgatacatctatgggatttaccccccttgaagggctcgttatgggcaccaga
agcggtgacattgatccagcaattgtcgttttccttcaggaacaggaaggcttaaccccg
aaagaaattaacgatctgctgaataaaaaaagcggaatgcttggcctaacggacggtaaa
tacagcgacatgcgtgagatagaagaaggtgctattgccaacgatcctgtgtgtaaactc
gctcacgatatctacgaatacagaatagccaaatacataggcgcatacaccgctgctatg
aacggtgttgacgcgatagccttcaccgctggtgtcggcgaaaacagcccttatcttcgt
gagaatgtcgtcaaaaaatatcttggttacttaggaatcaccctggatgaaaaagcaaac
gactgtaaatcctgtgagaaaatcatctccactcctgattctaaagtaaaagtcctcatc
gttccgacaaacgaggaacttgtgatagcaagagacactaaagaaatcgttgagaagggt
atcaaagaattgaaactgtggtaa

DBGET integrated database retrieval system