KEGG   Kosmotoga olearia: Kole_1870Help
Entry
Kole_1870         CDS       T00914                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
kol  Kosmotoga olearia
Pathway
kol00010  Glycolysis / Gluconeogenesis
kol00052  Galactose metabolism
kol00500  Starch and sucrose metabolism
kol00520  Amino sugar and nucleotide sugar metabolism
kol00521  Streptomycin biosynthesis
kol01100  Metabolic pathways
kol01110  Biosynthesis of secondary metabolites
kol01120  Microbial metabolism in diverse environments
kol01130  Biosynthesis of antibiotics
kol01200  Carbon metabolism
Module
kol_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kole_1870
   00052 Galactose metabolism
    Kole_1870
   00500 Starch and sucrose metabolism
    Kole_1870
   00520 Amino sugar and nucleotide sugar metabolism
    Kole_1870
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Kole_1870
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Kole_1870
Enzymes [BR:kol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Kole_1870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N MutL
Motif
Other DBs
NCBI-ProteinID: ACR80551
UniProt: C5CGH0
Position
complement(2005817..2006761)
Genome map
AA seq 314 aa AA seqDB search
MGLVIGIDLGGTETKIGLVDEHGKILNKTTIPTLVSRGREDVVARIANSIHNILDIANEK
DKVLAIGIGSPGSIDRDSGKVLFSPNFPDWRDFPLASMIRKHTGLETFIENDANAFILGE
WAFGKYKGSKHMIGLTIGTGIGSGVISHGQLITGHNGYAVELGHIIVEPNGPLCGCGSHG
CLEAVASATAIVRFAHEYRKRFPDSAIFSSEKIEAKTVIDAAKSGDELGKIIFDRFIDAL
ARGIGGFIHTFNPEVVIVGGGVSKAGDFLLKNLRERVDRYVMTSFKGTAKVDLSDLVEDA
GIKGAASIVFYRKR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgggattagttattggcatcgatcttggaggtacagaaactaaaataggtttggtagat
gaacatggaaagattctgaacaaaacaactattcccaccctggtttccagaggccgagaa
gatgtggtggcacgtattgccaatagtatacataatattctagacatcgcaaacgagaag
gacaaagtgcttgccataggaattggttcccctggatcaatagacagagatagcggaaag
gtcttattttcaccgaattttccggattggagagattttccccttgcttctatgataaga
aaacatacaggattggaaacttttattgaaaacgatgccaacgcttttatccttggtgaa
tgggcttttgggaaatataaaggtagtaaacatatgataggactcactatcggaacagga
attggtagcggagtcatttctcacggtcaactaataaccggccacaacggttatgctgtg
gaactcggacatattattgtggagccaaacggtccactctgtggctgtggttcacatggc
tgtttggaagcagtagcatccgcaacggcaattgtgcgttttgctcacgaatatagaaag
cgttttcctgattctgcgattttctcatctgaaaaaatagaggcaaaaaccgttatagat
gccgcaaaaagcggagatgaacttggaaaaattatttttgataggtttattgatgctctt
gcacgtggaataggtggattcattcacacgttcaacccggaagtagtaatagtcggcgga
ggtgtgagtaaagcgggagactttctactaaaaaaccttagagaacgggttgatagatac
gtaatgacttcattcaagggaacggccaaagtagatctaagtgatctggtggaagatgcc
ggaataaaaggggccgcttccatcgttttctatcgcaagaggtga

DBGET integrated database retrieval system