KEGG   Kosmotoga olearia: Kole_2022Help
Entry
Kole_2022         CDS       T00914                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kol  Kosmotoga olearia
Pathway
kol00010  Glycolysis / Gluconeogenesis
kol00051  Fructose and mannose metabolism
kol00562  Inositol phosphate metabolism
kol01100  Metabolic pathways
kol01110  Biosynthesis of secondary metabolites
kol01120  Microbial metabolism in diverse environments
kol01130  Biosynthesis of antibiotics
kol01200  Carbon metabolism
kol01230  Biosynthesis of amino acids
Module
kol_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kol_M00002  Glycolysis, core module involving three-carbon compounds
kol_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kole_2022
   00051 Fructose and mannose metabolism
    Kole_2022
   00562 Inositol phosphate metabolism
    Kole_2022
Enzymes [BR:kol01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Kole_2022
Exosome [BR:kol04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Kole_2022
  Exosomal proteins of bladder cancer cells
   Kole_2022
  Exosomal proteins of melanoma cells
   Kole_2022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACR80700
UniProt: C5CHM4
Position
2152456..2153205
Genome map
AA seq 249 aa AA seqDB search
MVAGNWKMNKSPTEAKLFAGLLASKIGKETVMDIVVFPPAIDIPFVVDVLKDTNIGVGVQ
NVHPKEKGAFTGETSLLMVKDLSVEYVLVGHSERRHIFGESDEFINEKVKAVLSAGLRPV
LCVGETLEEREKGLTKNVLERQIRLGLFGLEKEDVVNTVIAYEPVWAIGTGVVATPEQAE
EAMAFIRSLLGELYGMETAENVRILYGGSIKPENFDALIRLKNVDGGLVGGASLKESFIE
LVEIAKRYV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggttgctggtaactggaagatgaacaaatcccccacggaagctaaactttttgccggt
ttgctagcttcaaagattggaaaagaaacggttatggatattgtcgttttcccaccggca
atagatataccctttgttgttgatgtactaaaagacaccaatattggcgtgggagttcag
aatgttcacccgaaagaaaagggagctttcacaggagagacctcgttgctgatggttaaa
gatctcagtgtagaatatgttcttgttggtcattctgagcgcagacatatatttggagaa
agtgatgagttcatcaatgaaaaggtaaaagcggtattatccgcgggtttgaggcctgtt
ttatgtgttggtgaaacattggaagaacgtgaaaagggacttactaaaaatgtacttgaa
cgtcagataaggcttggactttttggtttagagaaagaggatgttgttaatacagtaata
gcatatgaaccagtatgggcaattggaacaggtgttgtggccaccccggaacaggcggag
gaagcaatggctttcataagatcgctgctcggggagctttacggtatggaaactgctgaa
aatgtacgaatactttatggcggtagtataaaaccagagaattttgatgcacttatacgc
cttaagaacgtggatggagggctcgtgggcggcgcgagtctcaaagaaagttttatagaa
ttagttgaaatcgcgaagcgttacgtatag

DBGET integrated database retrieval system