KEGG   Klebsiella oxytoca M1: HR38_00485Help
Entry
HR38_00485        CDS       T03349                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kom  Klebsiella oxytoca M1
Pathway
kom00071  Fatty acid degradation
kom00280  Valine, leucine and isoleucine degradation
kom00310  Lysine degradation
kom00362  Benzoate degradation
kom00380  Tryptophan metabolism
kom00620  Pyruvate metabolism
kom00630  Glyoxylate and dicarboxylate metabolism
kom00640  Propanoate metabolism
kom00650  Butanoate metabolism
kom00900  Terpenoid backbone biosynthesis
kom01100  Metabolic pathways
kom01110  Biosynthesis of secondary metabolites
kom01120  Microbial metabolism in diverse environments
kom01130  Biosynthesis of antibiotics
kom01200  Carbon metabolism
kom01212  Fatty acid metabolism
kom02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HR38_00485
   00630 Glyoxylate and dicarboxylate metabolism
    HR38_00485
   00640 Propanoate metabolism
    HR38_00485
   00650 Butanoate metabolism
    HR38_00485
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HR38_00485
   00072 Synthesis and degradation of ketone bodies
    HR38_00485
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HR38_00485
   00310 Lysine degradation
    HR38_00485
   00380 Tryptophan metabolism
    HR38_00485
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HR38_00485
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HR38_00485
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HR38_00485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kom04147]
    HR38_00485
Enzymes [BR:kom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HR38_00485
Exosome [BR:kom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HR38_00485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III HemY_N
Motif
Other DBs
NCBI-ProteinID: AIE66989
UniProt: A0A1P7U1V1
Position
106068..107258
Genome map
AA seq 396 aa AA seqDB search
MTQANDIVVVSGVRTAIGTFNGSLKHTHQHDLGAAVIREAIARAGLAPQDIDETIVGNVG
QIAESGFIARICQLRAGIPQESTAYSVNRQCGSGLQALADGMMQLQSGQAEVVVACGTEN
MTQLPYYLRKARDGYRMGHGELEDGLISILTWPEGPYHNGITAENVAQRFGITREAMDDF
AWSSQQKALKAIAEDRFREQILALEVPDGKKATRLFATDEHPRDTPREKLAALRPAFKAD
GVVTAANSSGINDGAAALVMMTRQQAEQRGLTPRMRIRGWAVAGCGAEIMGFGPSPATRR
LMDRLNMDVHAIDLIELNEAFAAQALAVMNDLRLDPARVNVNGGAIALGHPVGASGAILP
VKLMYEMARSGARTGLVTMCIGGGQGISMLFEREGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggctaatgatattgtggttgtcagcggcgttcgtaccgctattggcacgttt
aacggcagtcttaagcatacccaccagcacgatctcggggcagcggttattcgcgaagcg
atcgcccgcgccgggcttgcgccgcaggatatcgatgaaacgatcgtcggcaacgtcggg
caaatcgccgaaagcggttttatcgcccgcatctgccagctgcgggcggggatcccgcag
gagagcaccgcgtattcggttaaccgccagtgcggctccgggcttcaggccctggcggac
ggcatgatgcagctgcaaagcggccaggccgaggtggtcgtcgcctgcggaacggaaaat
atgacccagctgccctactacctgcgcaaagcgcgcgatggctatcgcatgggccacggc
gagctggaagatggactgatctccatccttacctggccagaagggccttatcacaacggc
atcacggcggaaaacgtcgcgcaacgcttcggtattacccgcgaagcgatggacgatttc
gcctggtcgagccagcagaaggcgctgaaggcgatcgctgaggatcgcttccgcgagcag
attctggcccttgaggtaccggacggcaaaaaagcgacccgcctgttcgcgaccgatgaa
cacccgcgcgacaccccgcgcgaaaagctcgccgcgctgcgtccggcatttaaagccgac
ggcgtggtgacggcggccaactcctccggcattaacgacggcgcggccgcgctggtgatg
atgacccgccagcaggcggaacagcgcggcttaaccccgcgcatgcggattcgcggctgg
gcggtcgccggctgcggcgcggagattatggggtttggcccctctcccgctacccgacgc
ctgatggaccgtctcaatatggatgttcacgccatcgatttaattgaactcaatgaggcc
ttcgccgcccaggcgctggcggtgatgaacgatctgcgtctcgatccagcccgcgttaac
gtcaacggcggcgcgatcgccctcggccacccggtgggcgccagcggtgcgatcctgccg
gtcaaactgatgtatgaaatggcgcgcagcggcgcacgcaccggtctggtcaccatgtgc
attggcggcggccaggggatttctatgctgttcgagcgcgaaggcgcttag

DBGET integrated database retrieval system