KEGG   Klebsiella michiganensis M1: HR38_02920Help
Entry
HR38_02920        CDS       T03349                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
kom  Klebsiella michiganensis M1
Pathway
kom03010  Ribosome
Brite
KEGG Orthology (KO) [BR:kom00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HR38_02920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:kom03011]
    HR38_02920
Ribosome [BR:kom03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HR38_02920
  Bacteria
    HR38_02920
  Archaea
    HR38_02920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AIE67446
UniProt: H3N3L0
Position
complement(588042..588374)
Genome map
AA seq 110 aa AA seqDB search
METLAQHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgccatgctcgttcttctgctcagaaggttcgccttgtt
gctgacctgattcgcggtaagaaagtgtcgcaggccctggatattctgacctacaccaat
aagaaagctgctgtactggtcaagaaggtactggaatctgccattgctaacgctgaacac
aacgatggcgctgacattgatgatctgaaagttgcgaaaattttcgtagacgaaggcccg
agcatgaagcgcattatgccgcgtgctaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system