KEGG   Klebsiella michiganensis M1: HR38_04255Help
Entry
HR38_04255        CDS       T03349                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
kom  Klebsiella michiganensis M1
Pathway
kom00051  Fructose and mannose metabolism
kom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HR38_04255
Enzymes [BR:kom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     HR38_04255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Plant_all_beta 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIE67698
UniProt: A0A249WHZ3
Position
881398..882546
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGENEQVDTV
SGVDAVSSIGDEVVELIASVDLVTTAVGPVVLERIAPAIAKGLAKRKAQGITAPLNIIAC
ENMVRGTTQLKGHVFNALAEEDKAWVEANVGFVDSAVDRIVPPSASATRDPLEVTVETFS
EWIVDKTQFKGELPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEHIRAVVKGAMEESGAVLIKRYAFDAQKHAAYIQKIIGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHRNLVKGIAAAMHFRSEEDPQAQELAALIAEKGPQAALAQ
ISGLDAASEVVAEAVNDYNATK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggcaaactgctg
gcggacgcggggatacagctgacgtttgcggatgtaaatcaggtcgtgctcgatgccctg
aatgcccgtcatagctaccaggttcacgtggtcggcgagaatgagcaggtcgataccgtt
tccggcgttgacgccgtcagcagcatcggcgacgaagttgtagagctgattgccagcgtg
gatctggtgaccaccgccgtcggcccggtcgtgctggaacgcatcgccccggcgattgcc
aaaggcctggccaaacgtaaggcgcaggggattaccgccccgctgaatatcatcgcctgc
gagaacatggtccgcggcaccacccagctgaagggtcacgtttttaacgccctcgccgaa
gaagacaaagcctgggttgaagccaatgtcggcttcgttgattccgccgttgaccgcatc
gttccgccgtcggcttccgccactcgcgacccgctggaagtcaccgtggaaaccttcagc
gagtggattgtcgataagacccagttcaaaggcgaactgccgaacatcccaggtatggaa
ttaaccgataacctgatggcatttgtcgaacgtaagctattcaccttaaacaccggacat
gctataaccgcctacctcggaaaactggcgggtcatcagacgattcgcgacgcgattctt
gatgagcacattcgcgccgtggtcaaaggcgccatggaagagagcggcgcggtgctgatc
aaacgctatgcctttgatgcgcaaaagcacgccgcttacatccagaaaattatcggtcgt
tttgagaacccgtatctgaaggatgacgttgagcgcgttggccgccagccgctgcgcaaa
ctgagcgcgggcgaccgcttaattaagccgctgctcggtacgctggaatacggcctgccg
caccgcaatctggtgaaagggatcgccgctgccatgcacttccgcagcgaagaagacccg
caggcgcaggaactggcggcgctgattgccgagaaaggcccacaggccgcgctggcgcag
atttcgggtctggacgcagcaagcgaggtggtggcggaagccgttaacgactataacgcc
accaaatga

DBGET integrated database retrieval system