KEGG   Klebsiella michiganensis M1: HR38_06785Help
Entry
HR38_06785        CDS       T03349                                 

Definition
(GenBank) PTS friuctose transporter subunit IIB
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
kom  Klebsiella michiganensis M1
Pathway
kom00051  Fructose and mannose metabolism
kom01100  Metabolic pathways
kom02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:kom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HR38_06785
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HR38_06785
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kom02000]
    HR38_06785
Enzymes [BR:kom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     HR38_06785
Transporters [BR:kom02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    HR38_06785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb PH_TFIIH
Motif
Other DBs
NCBI-ProteinID: AIE68156
Position
complement(1413462..1413956)
Genome map
AA seq 164 aa AA seqDB search
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVYNDDVRRTLLRQAAPPGMKVNVV
NIEKAVAVYHNPQYQDETVFYLFTNPQDVLTMVQQGVKIATLNIGGMAWRPGKKQLTKAV
SLDATDINAFQQLDTLGVKLDLRVVASDPSVNILDKIAEQSVTE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacgctcgcacgcattgatgaccgcctgattcacggccaagtcaccaccgtt
tggtcaaaagtggccaacgcccagcgcatcattatctgtaatgacgacgtgtataacgac
gacgttcgccgcacgctgcttcgccaggccgcgccgccgggcatgaaggtcaatgtggtg
aatattgagaaagccgtcgccgtttatcacaacccgcaatatcaggacgaaacggttttt
tatttattcactaatccgcaggacgtattaaccatggtgcagcagggcgtcaaaatagcc
acgctgaatattggcggcatggcctggcgaccgggtaaaaaacagttaaccaaagcggtg
tcattagacgcaacggatattaatgcctttcagcagttagatactctgggcgttaagctt
gatttacgcgtcgtggcttcagatccgtcggttaatattctcgataaaatagcagagcag
tccgttacagaataa

DBGET integrated database retrieval system