KEGG   Klebsiella michiganensis M1: HR38_08345Help
Entry
HR38_08345        CDS       T03349                                 

Definition
(GenBank) N-acetylneuraminate lyase
  KO
K01639  N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
kom  Klebsiella michiganensis M1
Pathway
kom00520  Amino sugar and nucleotide sugar metabolism
kom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HR38_08345
Enzymes [BR:kom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.3  N-acetylneuraminate lyase
     HR38_08345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: AIE68451
UniProt: A0A249WFD6
Position
complement(1735306..1736217)
Genome map
AA seq 303 aa AA seqDB search
MVSDKWQVFRGIISAVVTPMHADESVNYAALDALARAQLARGVEGFYCCGSSGEGPLLRF
DERRQVLATLVQSAGGRVPVIAHVGTPRTRDAVELAKHAEQDGASAVSLVPPYYYKYSRE
EIIAYYRRVLDAISIPVILYNIPQFTGVELDAQSADALLGDEQVLGVKHTSHNLYSLERM
IARYPEKVFFNGFDEIFLSSLAAGATATVGTTVNLQPELFLALRSAFQQGDIARAQRLQQ
QINEVVEQLVARGVFQSAKYLTAKETVDTGPTREPFVALTAAQKGELDDLYLRLRGYIAD
AGQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcgataaatggcaggtttttcgcggcattatctccgccgtggtgacgccgatg
cacgccgatgagtcggtgaactacgcggcgctggacgcgctcgcccgggcccagctggcg
cgcggggttgagggcttttactgctgcggctcctccggggaggggccgttgctgcgtttc
gatgagcgccggcaggtgctggcaacgctggtgcagtcggcgggcggtcgcgtgccggtg
atcgcccacgtggggacgccgcgcacccgggatgccgtcgagctggcgaagcacgccgag
caggacggcgccagcgcggtgtcgctggtgccgccctactactacaaatatagccgcgag
gagattatcgcctactaccgtcgggtgctggacgccatttcgattccggtgattttgtat
aatattccgcagtttaccggcgtcgagctggatgcccagagcgccgacgcgctgctcggc
gatgagcaggttctgggggtgaagcatacttcgcataacctctattcgctggaacgcatg
atcgcccgctacccggagaaagtcttttttaacggtttcgatgagatcttcctttccagc
ctcgcggcgggcgcgacggccacggttggcaccacggttaacctacagccggagctgttt
ctcgccctgcgcagcgcttttcagcagggcgacattgcccgggcgcagcgcctgcagcag
cagatcaacgaggtggtggagcagctggtcgcgcgcggcgtgttccagtcggcgaagtat
cttaccgcgaaagagaccgtcgataccggccccacccgcgagccgtttgtggcgctgacg
gcggcgcagaaaggcgagctggatgacctctatctgcgcttaagggggtatatcgccgat
gccggacaatga

DBGET integrated database retrieval system