KEGG   Klebsiella michiganensis M1: HR38_25800Help
Entry
HR38_25800        CDS       T03349                                 

Gene name
rluD
Definition
(GenBank) 23S rRNA pseudouridylate synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
kom  Klebsiella michiganensis M1
Brite
KEGG Orthology (KO) [BR:kom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:kom03009]
    HR38_25800 (rluD)
Enzymes [BR:kom01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     HR38_25800 (rluD)
Ribosome biogenesis [BR:kom03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    HR38_25800 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2 TruB_N CT47
Motif
Other DBs
NCBI-ProteinID: AIE71736
UniProt: A0A249WKZ5
Position
complement(5512108..5513088)
Genome map
AA seq 326 aa AA seqDB search
MAQRVQLNATVSENQLGQRLDQALAELFPDYSRSRIKEWILDQRVLVNGSVSDKPKEKVL
GGETIAIDVEIEEEVRFQPQDIPLNIVYEDDDILVINKPRDLVVHPGAGNPDGTVLNALL
HYYPAIADVPRAGIVHRLDKDTTGLMVVAKTIPAQTRLVESLQLREITREYEAVAIGHMT
AGGTVEEPISRHPTKRTHMAVHPMGKPAVTHYRIMEHFRIHTRLRLRLETGRTHQIRVHM
AHITHPLVGDQVYGGRPRPPKGASEEFITALRKFDRQALHATMLRLYHPISGIEMEWHAP
IPQDMVDLIDAMRADFETHKDDIDWL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacgagtacaactcaacgcaacggtgtccgaaaatcaactcggacaacgctta
gatcaggctttggccgaattgttcccggattattcgcgttcgcgcataaaagaatggatc
cttgaccagagagtgctggtaaacggcagcgtcagcgacaagccgaaagagaaagtgctg
gggggagaaacgattgctatcgatgttgaaatcgaagaagaagtccgtttccaaccacag
gatattccgctcaatatcgtttatgaagatgatgacatcctcgtaattaataaaccgcgc
gatttagttgtgcaccctggcgcgggcaaccctgacggtactgtgctgaatgcgctgttg
cactactatccggccattgctgacgtgccgcgtgcggggatcgtgcaccgtcttgataaa
gacaccaccggcttgatggtggtcgcgaagaccattccggcgcaaacccgcctggtggaa
tccctgcagctgcgcgaaatcacccgcgagtatgaagcggtggcgattggtcacatgacc
gctggcggaacggtggaagaaccgattagccgccacccgaccaagcgtacgcatatggcg
gtacatcccatgggaaaaccggcggtgacgcactatcggatcatggagcattttcgcatt
catactcgtctgcgtttgcgcctggagactggccgtacgcatcagattcgcgtacacatg
gcgcacatcactcacccgctggtgggcgatcaggtctacggcgggcgcccgcgtccgcct
aaaggcgcatcggaagagttcatcaccgctctgcgtaagttcgatcgccaggccctgcat
gccaccatgctgcgtttataccatccgatcagcggcattgagatggaatggcatgcgcca
attccacaggatatggttgatttgattgatgccatgcgcgctgattttgaaacccataaa
gacgatattgactggctatga

DBGET integrated database retrieval system