KEGG   Candidatus Kinetoplastibacterium oncopeltii: CONE_0100Help
Entry
CONE_0100         CDS       T02471                                 

Definition
(GenBank) aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
kon  Candidatus Kinetoplastibacterium oncopeltii
Pathway
kon00970  Aminoacyl-tRNA biosynthesis
kon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kon00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CONE_0100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:kon03029]
    CONE_0100
Enzymes [BR:kon01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CONE_0100
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CONE_0100
Mitochondrial biogenesis [BR:kon03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CONE_0100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AGF48640
UniProt: M1M9L2
Position
728584..730107
Genome map
AA seq 507 aa AA seqDB search
MTKQPLHTQFEEISSLRKAIIKGDISAVELAKSCLDTIESLAGINAFLDIRPETTISQAK
KVDKDISNGLISPLSGIPIAHKDVFVTTDWYTTSASKMLKGYLSPFNATVVERLSNAGAV
SLGKLNCDEFAMGSTNENSAYGPVANPWNYKKVPGGSSGGSAAAIAARMVVAATATDTGG
SVRLPAALCGVSGIKPTYGSTSRYGIIAFASSLDQAGIIANNSRNLLDILDIITGFDGKD
ATCLEKCNNITNQPGRIRADFDKHANRFNKNNSFPLKGIRIGLPKEFFGNNLSGEILKSV
TKAIYDFENLGASIVTISLPYTELTIPTYYVIASAEAYSNLSRFDGVRYGHRTKNYKTLD
EMITRSRAEGFGLEVKRRILLGAHMLSSENYEDFYLKAQCTRRIIAQDFKNALLNECDVI
MGPVSQETAKNIGEDSSNTLDWLGDMYTLGASLSGLPAMSIPCGFDNNKNLPIGLQIIGN
YFDEGLILALSDYYQHVTNWHKQYPKI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaaccattacacacacaatttgaagaaatatcatctctgcgtaaagctatt
attaaaggtgatataagtgctgtagaattagcaaaaagctgtttagatactattgaatct
ttagctggtataaatgctttccttgatataagaccagaaacaactatatcccaagcaaaa
aaagtagataaagatatttcaaatggattaattagtcctttatcaggcatcccgattgcc
cataaggatgtttttgttactacagactggtatacaacatctgccagcaaaatgctaaaa
ggatatcttagtccatttaatgcaaccgttgtagaaagactaagcaatgctggtgcagta
tcattgggaaaattaaattgtgatgaattcgctatgggatcaacaaatgaaaactctgca
tatggtccagttgctaatccttggaattataaaaaggttcccggtggatcatcgggtggt
tctgctgcagctatagctgcaagaatggtagtagctgctactgctactgatactggtgga
tcagtgagactaccagcagcgttatgtggtgttagtgggataaaaccaacatatggttct
acttcaagatacggcattattgcatttgcatctagcctagatcaggctggtataatagca
aataatagtagaaatttattagatattttagacataataacaggattcgatggtaaagat
gctacctgtttggagaaatgtaacaatataacaaatcagccaggtagaatacgtgcagat
tttgataaacatgctaatagatttaataaaaacaatagctttcctctaaaaggtatacgg
ataggacttcctaaagaattttttggaaataatctttctggcgaaattttaaaatcagtg
acaaaagcaatatatgattttgaaaatctaggagcatctatagttacaatttcattacca
tacactgagctaacaataccaacttattatgtaatagcttcagctgaagcctatagtaac
ctatctagatttgatggagttcgttatggtcacagaacaaaaaattataaaaccttagat
gaaatgattacaagatctagagctgaaggttttggtttagaagtgaaacgacgtatattg
ttaggtgctcatatgctatctagtgagaattatgaagatttttacttaaaagctcaatgt
accagaaggattatagctcaagatttcaaaaatgcattattaaatgaatgtgatgtaata
atggggccagtttctcaagaaactgcaaaaaacattggagaggactctagtaataccctg
gactggttgggtgatatgtatacattaggcgctagtttatcaggactgcctgcaatgtcc
ataccttgtggattcgataataataaaaatcttcctattggattacaaattattggaaat
tactttgatgaaggattaatattagctttgtctgattactatcaacatgttactaactgg
cacaaacaatatccgaaaatataa

DBGET integrated database retrieval system