KEGG   Candidatus Kinetoplastibacterium oncopeltii: CONE_0101Help
Entry
CONE_0101         CDS       T02471                                 

Definition
(GenBank) aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
kon  Candidatus Kinetoplastibacterium oncopeltii
Pathway
kon00970  Aminoacyl-tRNA biosynthesis
kon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kon00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CONE_0101
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:kon03029]
    CONE_0101
Enzymes [BR:kon01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CONE_0101
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CONE_0101
Mitochondrial biogenesis [BR:kon03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CONE_0101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AGF48641
UniProt: M1LX41
Position
730119..731588
Genome map
AA seq 489 aa AA seqDB search
MKSGWEIVIGLETHVQLATNSKIFSSSSTLFGSQPNKQTNEIDMALPGSMPSLNSKTVEY
AIRFGLAAGATISKNSVFERKHYFYPDLPKGYQISQFRNPIMKNGAISFYMDGEEKEVKL
TQAHLEEDAGKSLHKNYNSGIDLNRAGIPLLEIVTEPIIRSAKEAYMYAKALHNLVVWLG
ICDGNLQEGSFRCDANVSVRKSGSNILGTRTEIKNLNSFRFLEKAIIFESNRQIKLIENG
GHVIQETRLYDAENDETRSMRTKESATDYRYFPDPDLQILNISNEYISKIKESMPELPLT
RIKRFESDYCISREEALQMTVNIQTAEYFESVIKYIPKNYEKIVSNFISQELSTLMNRDN
KSIKENKITSYILASLINRVIDGSISNKNAKYVLSIMWDKGQYNIDEIIKEEGLDQINDI
SIITEIIDGVISKNKIAVMEYLSGKEKAFNSLIGQVMKASNGRINPRDINAMLKHSIELY
KKDLEKVET
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctggatgggaaatagtcataggtttagaaacacacgtgcaactagctacaaat
tctaaaatattttctagtagtagcacattatttggatcacaaccgaataaacaaacaaat
gaaatagatatggcgcttccaggaagcatgccttcattaaattctaagacagttgaatat
gctataagatttggtttagctgcaggagctacaatttcaaaaaattctgtatttgagaga
aaacactatttctatccagatttacctaaaggataccagattagccaatttagaaaccct
ataatgaagaatggtgcgatctctttttacatggatggagaagagaaagaagttaaatta
acacaagcacatttagaagaagatgccgggaagtccttacataaaaattataatagtgga
atagatcttaatagagcaggaatacctttattagaaatagtaactgaaccaataataaga
tcagctaaagaagcttatatgtatgcaaaagcattacacaacttagttgtttggttaggt
atatgtgatggcaatctacaagaaggatcatttagatgtgatgcaaatgtatctgttcgt
aaatcaggcagcaatattctcggaacgagaactgaaataaagaacttaaactcattcaga
tttttggaaaaagccattatatttgaatctaatagacaaattaagttaattgaaaatggt
ggacatgtaatacaagaaacaagattatatgacgcggaaaatgatgagactagaagcatg
agaacgaaagaaagtgctactgattacagatattttcctgaccccgatctacaaatatta
aatatatctaacgaatacatatcaaaaattaaagaaagtatgccagaacttcctttaact
agaataaagagattcgaatctgattactgtatttctagagaggaagccctgcagatgact
gttaatatacagacagctgaatattttgaatctgttattaaatatattccaaaaaactat
gaaaaaattgtttcgaattttataagccaagaattaagcactcttatgaatcgagataat
aaaagtatcaaggaaaataaaatcacaagttatatattagcgtcattaataaatagagtg
attgatggatcaatatcaaataaaaatgcaaaatatgttctatcaattatgtgggataaa
ggtcaatacaatattgatgaaataataaaagaagaaggcttggatcaaattaacgatata
tcaataattacagaaataatcgatggcgtcatatcaaagaataagattgctgttatggaa
tatctgtctggaaaagaaaaagcattcaattcattaataggtcaagtaatgaaagcaagc
aatggcagaatcaatcccagagatataaatgctatgttaaaacatagcatagagctatac
aagaaagacttggaaaaagttgaaacataa

DBGET integrated database retrieval system