KEGG   Kosakonia oryzae: AWR26_00190Help
Entry
AWR26_00190       CDS       T04433                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kor  Kosakonia oryzae
Pathway
kor00071  Fatty acid degradation
kor00072  Synthesis and degradation of ketone bodies
kor00280  Valine, leucine and isoleucine degradation
kor00310  Lysine degradation
kor00362  Benzoate degradation
kor00380  Tryptophan metabolism
kor00620  Pyruvate metabolism
kor00630  Glyoxylate and dicarboxylate metabolism
kor00640  Propanoate metabolism
kor00650  Butanoate metabolism
kor00900  Terpenoid backbone biosynthesis
kor01100  Metabolic pathways
kor01110  Biosynthesis of secondary metabolites
kor01120  Microbial metabolism in diverse environments
kor01130  Biosynthesis of antibiotics
kor01200  Carbon metabolism
kor01212  Fatty acid metabolism
kor02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWR26_00190
   00630 Glyoxylate and dicarboxylate metabolism
    AWR26_00190
   00640 Propanoate metabolism
    AWR26_00190
   00650 Butanoate metabolism
    AWR26_00190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AWR26_00190
   00072 Synthesis and degradation of ketone bodies
    AWR26_00190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AWR26_00190
   00310 Lysine degradation
    AWR26_00190
   00380 Tryptophan metabolism
    AWR26_00190
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AWR26_00190
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AWR26_00190
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AWR26_00190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kor04147]
    AWR26_00190
Enzymes [BR:kor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AWR26_00190
Exosome [BR:kor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AWR26_00190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ANI80638
Position
38453..39640
Genome map
AA seq 395 aa AA seqDB search
MKDTDIVILGAARTAIGSLNGSLANISSPKLGSIVIKSLLEKSHISEKEVDEVIIGQVLT
AGCGQNPARQTLIHSGISQDVPALTINKVCGSGMKALQLAYQSLKCGEAELIIAGGQENM
SQSPHILPHSRNGMKMGNWQMQDSMVNDGLWDAFHDYHMGMTAENIAEKYGITREEQDEF
ALASQRKAAAALETSRFDSEIAPVVIIKPGKEPIVVEKDEFPRPQTTREGLAKLRPAFKK
EGTVTAGNASGVNDGAAMVILATAKKARELGITPLGRVVEFATSGVAPEIMGTGPIEASR
NVLKKSNWQVSNLDLIEANEAFAAQAIAVNREMGWDLTKVNVNGGAIALGHPIGASGARI
FVSLIHEMQRRKSKKGLATLCIGGGMGIAVTVEMD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacactgatattgttatacttggtgcagcaaggacagctattggctcgcttaat
ggttcccttgccaatatatcttcacctaaactgggatctatagtgattaaatcacttctt
gaaaaatctcatatttcagaaaaagaggtggatgaagtaatcattggtcaggttttaacg
gcggggtgtgggcaaaatccagcgcgacaaacattaattcattccggtatttcacaggat
gttcccgcgctgacaattaataaagtttgtggctcaggaatgaaagcattacagcttgca
tatcagtcattaaagtgcggtgaagcggagctgattattgcgggcgggcaagaaaatatg
agtcagtcgccgcatattctccctcactcccgtaatggaatgaaaatgggcaactggcaa
atgcaggacagcatggttaatgatggattatgggacgcattccatgattatcacatgggg
atgaccgcggaaaatatcgcggagaaatatggcattacgcgtgaagagcaggatgaattt
gcgctggcctcacagcgtaaagccgctgcggctcttgagacttcccgttttgacagcgag
attgcgccggttgttattatcaaacccggtaaagaacccatcgtagttgaaaaagatgaa
tttccgcgtccgcaaactacgcgtgaagggctggcaaaattacgcccggctttcaagaaa
gagggaaccgtaaccgccggcaacgcttccggggtaaatgatggcgcggctatggttatt
ttggctactgcgaaaaaagccagagaactgggtattacgccgcttggccgggtcgttgaa
tttgcgacctcaggcgttgcaccggaaataatgggaaccgggccgattgaagcttcccga
aatgtacttaaaaaatcaaactggcaggtcagcaatcttgatctcattgaagccaatgaa
gcgtttgcggcgcaggctatcgcggttaatcgagaaatgggctgggatctgacgaaagtg
aatgttaatggcggcgccattgctctcggtcaccctattggcgcgtctggcgcccgtatt
tttgtgtcgttaattcatgaaatgcagcgccggaaaagtaaaaaaggtctggcgacatta
tgcattggcggcggcatgggtattgctgtcacggttgagatggattaa

DBGET integrated database retrieval system