KEGG   Kosakonia oryzae: AWR26_02085Help
Entry
AWR26_02085       CDS       T04433                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
kor  Kosakonia oryzae
Pathway
kor03010  Ribosome
Brite
KEGG Orthology (KO) [BR:kor00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AWR26_02085 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:kor03011]
    AWR26_02085 (rplV)
Ribosome [BR:kor03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AWR26_02085 (rplV)
  Bacteria
    AWR26_02085 (rplV)
  Archaea
    AWR26_02085 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ANI80994
UniProt: A0A1T5H171
Position
452380..452712
Genome map
AA seq 110 aa AA seqDB search
METLAQHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgccatgctcgttcttctgctcagaaggttcgccttgtt
gctgacctgattcgcggtaagaaagtgtcgcaggctctggatattctgacctacaccaac
aagaaagcggctgtactggtcaagaaagttctggaatctgccattgctaacgctgaacac
aacgatggcgctgacattgacgatctgaaagttgcgaaaattttcgtagacgaaggcccg
agcatgaagcgcgttatgccgcgtgcgaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system