KEGG   Kosakonia oryzae: AWR26_04885Help
Entry
AWR26_04885       CDS       T04433                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kor  Kosakonia oryzae
Pathway
kor00052  Galactose metabolism
kor00500  Starch and sucrose metabolism
kor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AWR26_04885
   00500 Starch and sucrose metabolism
    AWR26_04885
Enzymes [BR:kor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AWR26_04885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_43 DUF4975 Glyco_hydro_32C Glyco_hydro_130
Motif
Other DBs
NCBI-ProteinID: ANI81518
Position
1018793..1020286
Genome map
AA seq 497 aa AA seqDB search
MRTFISATVVALLVLSGGNTPVYSQMSKETLQNKSITQVNGFFPRVEGSFVGDPMPVYNE
GVFNIFYLNDVRGGSDLGVHAIHLLTSANLYNYQNHSEVIPYVNNVNNPELLLGTGSIIK
VGDTWHAWYTAHNENVFPVESVMHATSKDRLHWVKHPQDTILPGDNYRGNDFRDPHVVWV
EEKKEYWMLITTRSNGRGIIARYSSTDLKNWQDRGVFFDNDTITSNSNLECPTLVFFNGR
WYLSFSDQWPLRLTQYRVADNPEGPWHKLDNYVVDGSGFYAGKLAIKDGRLFVFGWIPTK
AGNNDRGNIDWAGNLVVHELTADTKGQLNSIMPRELQKAIKDNRGQVQTILPVKTLKTST
QFGPLHSSIYPSLPRRGELSATVDIPSSGMVMSFGLTDDQVSDATLNVVFNRSKGKVYFF
NSPLASINQSNAESWVDIPLGEKINFRVLIQNSIAVFYINDKAAFSTRMYSMPDKPWSIS
LPQQDSLHAKLQFKEMI
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagaacttttatttcagcgactgtcgttgctttgctggtactttctggtggaaataca
cccgtatattcacagatgtctaaagaaacattacagaacaaaagtatcacccaggttaat
ggctttttccctcgtgtcgaggggtcatttgttggtgatccaatgcctgtttataacgaa
ggtgtatttaatattttttaccttaatgacgtgcgcggcggcagcgatttaggggtccat
gcgattcacctgctcaccagcgccaacttatataattatcagaaccattctgaagtcatt
ccttacgttaataacgtcaataatccagagctgctcctgggtaccggctccattatcaaa
gtgggcgatacctggcacgcctggtataccgcccataatgaaaacgtctttccggttgaa
tccgtcatgcatgccaccagtaaagatcgtcttcactgggtgaaacatccacaggacact
atcctcccgggcgataactatcgcggtaatgactttcgcgatcctcacgttgtctgggtt
gaagagaagaaagagtactggatgctgatcacgacccgcagcaacggtcgcggcattatc
gcgcgttatagctcaacggatttaaaaaactggcaagaccgtggtgtattttttgacaat
gacaccattaccagtaattcaaatcttgaatgcccgacacttgtcttctttaacgggcgc
tggtatctgagcttcagcgatcagtggccactgcgtctgacgcagtatcgcgttgcagat
aatccggaaggaccgtggcataagctggataattatgttgtcgatggctccggtttttat
gccggtaaactggctattaaggatggtcgtttatttgttttcggctggatcccaactaaa
gcgggaaacaatgacagggggaatatcgactgggcaggaaacctggtcgtacatgaattg
actgctgacacaaaaggtcagctcaacagcattatgccacgagagcttcagaaagcgata
aaagataaccgtgggcaggttcagacgatactgcctgttaaaacgctcaaaacgtcaacg
caatttggcccattacattcatctatttatccctctttaccgaggcgtggagagttgtcc
gcaacggtggatattccctcttcgggaatggtcatgagctttgggctgacagatgaccag
gtgagtgacgcgacgctgaatgttgtgttcaacaggagtaaaggtaaagtctatttcttt
aattctcctttggcatcgattaaccaaagtaacgctgaatcctgggttgatattccgctc
ggtgaaaaaattaatttccgcgtgcttatacagaactcaattgccgttttttatattaac
gacaaagcggcatttagcacccggatgtattccatgccggacaaaccctggagcatcagt
ctgcctcaacaagatagtctccacgcaaaattgcaatttaaagaaatgatctaa

DBGET integrated database retrieval system