KEGG   Kosakonia oryzae: AWR26_12195Help
Entry
AWR26_12195       CDS       T04433                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
kor  Kosakonia oryzae
Pathway
kor00620  Pyruvate metabolism
kor00630  Glyoxylate and dicarboxylate metabolism
kor01100  Metabolic pathways
kor01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWR26_12195
   00630 Glyoxylate and dicarboxylate metabolism
    AWR26_12195
Enzymes [BR:kor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     AWR26_12195
    1.2.1.22  lactaldehyde dehydrogenase
     AWR26_12195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC OmdA
Motif
Other DBs
NCBI-ProteinID: ANI82877
Position
2583608..2585047
Genome map
AA seq 479 aa AA seqDB search
MTAPVQHPMFIDGQFISWQGDNWLDVVNPATEEILARIPDGTAEDARKAIAAAERAQPAW
EALPAIERAGWLRKIAAGIREKAHEISALIVAEGGKIQQLAEVEVSFTADYIDYMAEWAR
RYEGEILQSDRPNENIFVFKRALGVTTGILPWNFPFFLIARKMAPALITGNTIVIKPSEF
TPNNAVAFAQIVHDVGLPKGVFNLVLGRGETVGQELAANPKVAMVSMTGSVGAGEKIMAA
AAKNITKVCLELGGKAPAIVLDDADLELAVKAIVDSRIINTGQVCNCAERVYVQKGIYDR
FVNRLGEAMKAVQFGDPAQRNDIAMGPLINAAARERVEQKVARAVAEGARVVLGGKAPEG
KGYFYPPTLLLDVRQEMAIMHEETFGPVLPVVAFDTLDDALAMANDSDYGLTSSVYTKDL
NTAMKAVRGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGRHGLNEYLQTQMVYLQS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacggcacccgtgcaacacccgatgtttatcgatggtcaattcatcagctggcagggc
gacaactggcttgatgtcgtcaacccggcgacggaagagattctggcgcgcattcctgat
ggcacagcggaagatgcgcgtaaagcgattgcggcggcggaacgcgcccagcctgcctgg
gaagccttgccagcaatagaacgcgcaggctggttacgtaaaatcgcggcagggattcgc
gagaaagcgcatgaaatcagcgcattaattgtggctgagggcggcaaaattcagcaactg
gctgaggtggaagtctcctttaccgccgactacatcgactatatggccgaatgggcgcgc
cgctatgaaggggagatcctgcaaagcgaccggcccaatgaaaatatctttgtctttaag
cgcgcccttggcgtgacgaccggcattttgccgtggaattttccgttcttcctgattgcc
cgcaaaatggcgccagcgttgattaccggcaacaccattgtgattaaacccagcgagttc
acgcccaacaacgccgtcgcgtttgcccaaattgtgcatgatgtcggattgccaaaaggg
gtctttaacctggtattaggacgcggcgaaacggttggccaggagctggcagccaacccg
aaagtagcgatggtcagcatgaccggcagtgttggcgctggcgagaaaatcatggcggcg
gcggcgaaaaatatcaccaaagtgtgtctcgaacttggcgggaaagcgccagccattgtg
ctggacgatgcggatcttgagctggcggtgaaagcgattgttgattcccgcatcatcaac
accgggcaggtgtgtaactgcgccgagcgggtgtatgtgcagaaggggatttacgaccgt
ttcgttaaccgtcttggcgaagcgatgaaagcggtgcagtttggcgatccggcgcagcgt
aacgacattgccatggggccgctcatcaacgctgccgcacgggagcgtgtggagcagaaa
gtggcacgtgcggtggcagaaggcgcgcgcgtggtgctgggcggcaaagcgccggaaggg
aaaggctatttctatccgccaacgctgctgctggatgtccgccaggaaatggcgatcatg
cacgaagagacctttgggccggtgctgccggtggtggcattcgacacgctcgatgacgcg
ctggcaatggccaatgacagcgattacggtctgacatcttccgtctataccaaagatctg
aatacggcgatgaaggccgtgcgcgggctgaaattcggcgaaacgtatattaaccgggag
aactttgaagcgatgcaggggttccatgccgggtggcgcaagtccgggatcggcggggcg
gatgggcgtcacggcctgaacgaatatctgcaaactcagatggtgtatctgcaatcctga

DBGET integrated database retrieval system