KEGG   Kosakonia oryzae: AWR26_16645Help
Entry
AWR26_16645       CDS       T04433                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
kor  Kosakonia oryzae
Pathway
kor00260  Glycine, serine and threonine metabolism
kor01100  Metabolic pathways
kor01110  Biosynthesis of secondary metabolites
kor01120  Microbial metabolism in diverse environments
kor01130  Biosynthesis of antibiotics
kor01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AWR26_16645
Enzymes [BR:kor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AWR26_16645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ANI83708
Position
3544134..3545132
Genome map
AA seq 332 aa AA seqDB search
MIDLRSDTVTRPGRAMLEEMMAAPVGDDVYGDDPTVNELQRYAAELSGKEAALFLPTGTQ
ANLVALLSHCERGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAADGTLPLDKVAAKI
KADDIHFARTKLLSLENTHNGKVLPRDYLKQAWEFTRERGLSLHVDGARIFNAIVEYGCD
LSAIAQYCDSFTICLSKGLGTPVGSLLVGDKAYITRANRWRKMTGGGMRQAGILAAAGLY
ALKHNVARLKEDHENAAWLAAQLQEIGADVMRHDTNMLFVRVGEPAAALGAFMRERDVLI
NASPVVRLVTHLDVNRQQLTEVVRHWQAFLQR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgattgatttacgtagtgataccgtaacccgcccggggcgcgccatgctcgaagagatg
atggccgccccggtcggggacgatgtttacggtgatgatcccaccgtcaacgaactgcag
cgttacgcagcagaactcagcggcaaagaagccgcactgtttctgccgaccggaacgcag
gccaacctggtggcgctgttaagccactgcgagcgcggcgaagagtatattgtcggccag
ggagcgcataactatctctacgaagcgggcggcgcagcggtgctcggcagcattcagccg
cagcccattgatgccgccgccgacgggacgctgccgctggacaaagtcgcggcaaaaatc
aaagccgatgacatccacttcgcacgcaccaaactgctcagtctggaaaatacccacaac
ggcaaagtactgccgcgcgactacctgaaacaggcgtgggaatttacccgcgagcgcggg
ctgtcgctgcacgttgatggcgcacgcatctttaacgccatcgtggaatacggctgcgac
cttagcgcgatcgcgcaatattgcgactctttcaccatctgcctgtcgaagggcctcggc
acgccggtcggttcattactggtgggcgacaaagcttatatcacccgcgccaaccgctgg
cgcaaaatgaccggcggcggtatgcgccaggccgggatccttgccgcagcgggtctgtat
gcgctgaagcacaacgtcgcgcggctgaaagaggatcacgagaacgccgcctggctggcc
gctcagttgcaggaaattggtgccgacgtgatgcgccacgacaccaatatgttgttcgtc
cgcgttggcgaaccggccgcagcgttgggagcgtttatgcgcgagcgcgatgtgctaatc
aacgcgtcgccggtggtgcggctggtcacccatctcgacgtcaatcgccagcagctcacc
gaggtagttcgccactggcaggcttttttacagcgctaa

DBGET integrated database retrieval system