KEGG   Kosakonia oryzae: AWR26_17935Help
Entry
AWR26_17935       CDS       T04433                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
kor  Kosakonia oryzae
Brite
KEGG Orthology (KO) [BR:kor00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AWR26_17935
Enzymes [BR:kor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     AWR26_17935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ANI83935
Position
complement(3825961..3826749)
Genome map
AA seq 262 aa AA seqDB search
MIVAAGQFAVTPDWKTNALTCVELMAQAAQQQASLLVLPEALLARDDADPYLSVKSAQRL
DGDFLRLLLDESRLNSMTTVLTVHVPSMEGRAVNTLVVLCRGEIVAQYAKLHLYDAFNMQ
ESARVDAGSILPPLIEVDGMLVGLMTCYDLRFPELALSLALAGAQLLVLPAAWVRGPLKE
QHWATLLSARALDTTCYMVAAGECGNKNIGQSRVIDPQGVTIAAAAEAPQLIYADVTAAR
VTQTREKLPVLQNRRFAPPQLL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgattgttgcagccgggcagtttgccgttacaccggactggaaaactaatgcattaact
tgtgtcgaattgatggcgcaagcggcacagcaacaggcgtcgctgctggtgctgccagag
gcattactcgcccgggatgatgctgacccctatctttcggtaaaatcggcgcagaggctg
gatggcgattttctgcgcctgcttcttgatgagagccgcctaaacagcatgaccactgtg
ctgacggtgcatgtgccctccatggaagggcgggcagtcaatacgctggtggtgttatgc
cggggggagatcgttgcacagtatgcaaagctgcatctctatgatgcatttaatatgcag
gagtcggcgcgggtggatgcaggcagcattctgccaccgctgattgaggttgacggaatg
ctggtcgggttgatgacctgttatgatttgcgatttccggagctggcgctgtcgctggcg
cttgcgggcgcacaactgttggttctgcctgccgcgtgggtgagagggccgctaaaagag
caacactgggcgacgttactttctgcgcgggcgctggataccacctgttacatggtggct
gccggggagtgtggcaacaagaatatcggtcagagtcgggttatcgatccccagggtgtt
actattgctgccgccgctgaagcaccacaactgatctatgcggatgtcacggcagcccgt
gtgacgcaaacgcgagagaaacttcccgttttgcagaatcgacgctttgcgccgccgcaa
ctcctgtga

DBGET integrated database retrieval system