KEGG   Kosakonia oryzae: AWR26_21215Help
Entry
AWR26_21215       CDS       T04433                                 

Gene name
folA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
kor  Kosakonia oryzae
Pathway
kor00670  One carbon pool by folate
kor00790  Folate biosynthesis
kor01100  Metabolic pathways
Module
kor_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AWR26_21215 (folA)
   00670 One carbon pool by folate
    AWR26_21215 (folA)
Enzymes [BR:kor01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AWR26_21215 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ANI84550
Position
complement(4543270..4543749)
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNI
VISSQPGTDDRVEWVKSVDEAIAACGDVEEIMVIGGGRVYEQCLPKAQRLYLTHIDAEVE
GDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtctgattgccgcgctagccgtggatcgcgtgattggtatggagaacgccatg
ccgtggaatttaccggccgatctcgcctggtttaagcgcaataccttaaacaaaccggtg
gtgatggggcgtctgacgtgggaatccatcggccgtccgttaccggggcgcaaaaacatt
gtgatcagcagccagccgggtactgacgatcgtgtcgaatgggtgaaatccgtggatgaa
gcgattgccgcctgcggcgatgtggaagagatcatggtgatcggcggcgggcgagtttac
gaacagtgtctgccgaaggcgcagcgcctctacctgacgcacattgatgctgaagtggaa
ggtgatacccacttcccggattacgagccggacgactgggaatccgtatttagcgaattc
catgatgctgatgcgcagaactcgcatagctactgctttgagatcctcgagcgccgctaa

DBGET integrated database retrieval system