KEGG   Kordia sp. SMS9: KORDIASMS9_02234Help
Entry
KORDIASMS9_02234  CDS       T05562                                 

Gene name
xynC
Definition
(GenBank) glucuronoxylanase XynC
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
kos  Kordia sp. SMS9
Pathway
kos00511  Other glycan degradation
kos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    KORDIASMS9_02234 (xynC)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    KORDIASMS9_02234 (xynC)
Enzymes [BR:kos01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     KORDIASMS9_02234 (xynC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: AXG70005
UniProt: A0A345H0B7
Position
complement(2490988..2492628)
Genome map
AA seq 546 aa AA seqDB search
MNVLNTPSIVKLTKPNTTFLKTLIAAILITACTSKKSEFSSVEVYQTSASGDNLKLIPQN
AMQSSTDNGEKISLLIKPNQKFQEYIGFGASFTESSAWNLATIPETLRKEVLTKLFSPTK
GAGFSLTRTHINSSDYANNHYSYVEENDTDLSTFTINEDIKGFSGNENDQVKGIELVTPS
YDMIPMILEASNIKNADFKIIASPWSPPSWMKQGETAEMTNGSLKPEFYGVWATYLSKYI
SAYAEKGINIWGITPQNEPLHAHDARWDSNGFSPEQGRDFLKNHFGPQLVKDGHLTLDNL
NSGVRVLIYDHNKSTMNNYVNATYNDPEAAKYAWGTAFHWYASSELEKNNYHAEALDSLR
TNWQGKGMIHTESSIDIDANDPVGQYWRESTDYAGTFVPFDTYIYDIITDLNHGTQGYVE
WCMILSNKGQPNPYDNFNSAPVLINPITDEVIYTPLYYLLSHFSKFIRPGARRIAIEGKK
AEGIVYTAAKNPDKSIAVVVFNKTEKPVGIEFTLQNETHNIEIAPRALQTIHFKNNSSDE
KHLNHH
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtcctgaatacaccatcaatagtgaaactcacaaaaccgaatacaacattttta
aaaacactcattgcagctattttaattacagcctgtacttctaaaaaaagtgaattctca
tctgtagaagtttatcaaacctcggcgtctggcgataatcttaaattaattccacaaaac
gctatgcaatcatccactgacaatggtgaaaaaattagtttgcttataaaaccgaatcaa
aaatttcaagaatatattggttttggagcttctttcacagaatcgtccgcgtggaatttg
gcaaccattccagaaacacttcgcaaagaagtcctaacaaaacttttcagtcccacaaaa
ggtgctggattttcacttacgcgaacacacatcaacagtagtgactacgctaataatcat
tacagttatgttgaagagaatgatacagacctttctacatttacgatcaatgaagacatc
aaaggattttcaggtaacgaaaatgatcaagtaaaaggtattgaattggtaacgcctagt
tatgatatgattccaatgatattggaagcttctaatattaaaaatgcagactttaaaatt
attgcttctccttggagtccgccttcttggatgaaacaaggagaaactgctgaaatgaca
aacggttctttaaaaccagaattttatggtgtttgggctacctatctttcaaaatatata
agtgcttacgctgaaaaaggcatcaatatttggggaataacacctcagaacgaaccatta
catgcacacgatgcacgttgggatagcaatggattctctccagaacaaggacgcgatttt
ttaaaaaatcattttggtccgcaacttgtcaaagacggacatcttactcttgataattta
aattctggtgtacgcgtgttgatatatgaccacaataaatctacaatgaataattatgta
aacgctacctacaatgatccagaagcagctaaatatgcttggggaacagcttttcattgg
tacgcgagctcagaacttgaaaagaataactatcatgcagaagcattagatagcctaaga
acaaattggcaaggaaaaggaatgattcatacagaatctagcattgatattgacgcgaac
gatcctgtagggcaatattggagagaaagtacagattacgcaggtacttttgtgcctttt
gacacatacatttacgatatcatcaccgatctcaatcacggtacgcaaggctatgtggaa
tggtgtatgattctcagcaacaaaggacaacccaatccgtatgataattttaatagtgca
ccagtcttgatcaatccgataacggacgaagtcatatatacgccgctctactatttactc
agccattttagcaaatttatacgacctggagcgcgcagaattgctattgaaggtaaaaaa
gcggaaggtattgtgtatactgcggctaagaatcctgacaaatctatcgctgttgttgtt
tttaataaaaccgagaagcctgtaggtatcgaattcactttacaaaacgaaactcacaac
atagaaattgcgccaagagcattgcaaaccattcattttaagaataattcttctgacgag
aagcacttgaatcatcattaa

DBGET integrated database retrieval system