KEGG   Kordia sp. SMS9: KORDIASMS9_03299Help
Entry
KORDIASMS9_03299  CDS       T05562                                 

Definition
(GenBank) alpha-ketoglutaric semialdehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
kos  Kordia sp. SMS9
Pathway
kos00040  Pentose and glucuronate interconversions
kos00053  Ascorbate and aldarate metabolism
kos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KORDIASMS9_03299
   00053 Ascorbate and aldarate metabolism
    KORDIASMS9_03299
Enzymes [BR:kos01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     KORDIASMS9_03299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AXG71044
UniProt: A0A345H3A6
Position
3781714..3783297
Genome map
AA seq 527 aa AA seqDB search
MITGKNYIGNSLSAKGNIAYTTFNPKTNTANENVYTEATSEEIQEAVNLASEAFKEFRTI
SGAKKAAFLNAIADEILALDDELVQTYMSETGLPEGRAKGERGRTIGQLRTFAKLIEEGS
WVEARIDPAQSERTPNPRVDLRKMLVPIGPIVVFGASNFPLAYSTAGGDTASALASGCPV
IVKSHPMHAGTGELVASAIAKAVQKTGMPNGVFSNLNSSGIEVGQELVSHPKVKGVGFTG
SIRGGRALFDLASKRKEPIPVFAEMGSINPVILLPKALENKGESWAKTYAKSITLGTGQF
CTNPGLILGIQSESLTNFINVLSEEIVQIQPQCMLHPNIHAAYTNNKLQAQDQHNVTTVA
AITETVTENYAQQAVATVDGKAFLENSTLHEEVFGPFSLVVQCKNAAELEAIIANLEGQL
TGTVISEENEVSDYDNIIKALSDRVGRIIFNGVPTGVEVVPAMLHGGPYPASTDSRFTAV
GRDAIKRWVRPFSYQDFPNALLPDALKDENPLGILRLVNDQETKEAL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgattactggaaaaaactatataggaaactcgctttccgcgaaaggaaatattgcgtat
acaactttcaacccaaaaacaaatacggctaacgaaaacgtatataccgaagcaacttcg
gaagaaattcaagaagccgtaaatttggcttcagaagcttttaaggagtttagaacgatt
tctggcgcaaaaaaagcagcatttttaaatgcaatcgcagatgaaattttagctttggat
gatgaattagtccaaacttacatgtcagaaacaggtttaccagaaggaagagccaaaggc
gaacgcggcagaaccatcggacaattacgaacttttgccaaactcattgaagaaggttct
tgggtagaagcacggattgatcctgcacaatcagaaagaacaccaaatccgagagtcgat
ttacgcaaaatgttagttccaattggaccgattgtcgtttttggcgcgagtaactttccg
ttagcctattctacggctggtggcgataccgcttccgcattggcttctggttgtcctgtt
attgtaaaatcgcatccaatgcacgctggaacaggtgaattggtagcttcggcaatcgcg
aaagcagtacaaaaaacgggcatgccaaatggcgtattttcaaatctaaacagtagcgga
attgaagtcggacaagaattagtttcacatccaaaagtaaaaggcgttggatttacagga
agtattcgtggcggacgtgctttgttcgatttagcttcaaaacgaaaagaacccattcca
gtatttgctgaaatgggaagtataaatcctgtgattctattgccaaaagcattggaaaac
aaaggagaatcttgggcaaaaacctatgcaaaatcaatcactttaggaacaggtcaattt
tgcacaaatcctggattaattttgggaatacaaagtgaaagtttgactaattttataaat
gttttatcggaagaaattgtacaaatacaaccgcaatgtatgttgcatccaaacattcac
gcggcgtatacaaacaataaattacaagcacaagatcaacacaatgtgactacggtggct
gcaattacggaaacggtaacagaaaactatgcacaacaagcagtggcaacagttgatgga
aaagcattcttagaaaattcgactttacatgaagaagttttcggtccattttcactagtg
gtacaatgtaaaaatgcagcggaattggaagccattattgcaaacttagaaggacaattg
acaggaacagtgatttctgaagaaaacgaagtttctgactatgataacattataaaagca
ctatctgacagagttggaagaatcatttttaacggcgttcccactggtgtggaagttgtg
cctgcaatgttgcatggtggaccatatccagcgtctactgacagtcgttttacggcggtt
ggtagagatgcaattaaacgttgggtgcgaccgtttagctatcaagattttccaaatgca
ctcttgccagatgcattaaaggacgagaatccattaggaattcttcgattggtaaatgat
caagaaacaaaagaagctttgtaa

DBGET integrated database retrieval system