KEGG   Kordia sp. SMS9: KORDIASMS9_03527Help
Entry
KORDIASMS9_03527  CDS       T05562                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
kos  Kordia sp. SMS9
Brite
KEGG Orthology (KO) [BR:kos00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kos03016]
    KORDIASMS9_03527 (truC)
Enzymes [BR:kos01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     KORDIASMS9_03527 (truC)
Transfer RNA biogenesis [BR:kos03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    KORDIASMS9_03527 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AXG71270
UniProt: A0A345H3Y2
Position
complement(4031998..4032732)
Genome map
AA seq 244 aa AA seqDB search
MCDLQVSFLILHMILYEDDFVVAVAKPNNMLVHHSAMARNQSEAQTLVEILFETFGKHFY
PMHRLDRKTSGIVLCAKEKQYVSAFQELFITNQIEKVYYGVVRGFSPEKGTIDSPVKGRD
ATVHKDALTHFETVTTIELPIPVQPFETSRYSLVKLLPNTGRMHQLRIHLNKISHPLIGD
PKYGDRYHNRMFQAEFEIFELFLHAASLSFVHPFLQKPMVIPCSFPRHWHKISEKCNWDL
TDDC
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatttgcaggtaagtttcttaattttacacatgattttatacgaagatgatttt
gtggttgcggtagcaaaacctaacaatatgttggtacatcattcggcaatggcgcgaaat
cagtcggaagcacaaaccttggttgaaatactgtttgaaacattcggaaaacacttttat
ccgatgcatcgcttagacagaaagacttcgggcattgtgttgtgtgcgaaagaaaaacag
tatgtttcggcttttcaagaacttttcattacgaatcaaattgagaaagtgtattatggc
gtcgtcagaggattttctcccgaaaaaggaactattgattctcctgtaaaaggcagagat
gcaactgttcataaagatgcgctgacacattttgaaactgtaacaacaattgaattgcca
attcctgtacaaccgtttgaaacgtcacgctatagtttggtaaagctgcttcccaacaca
ggcagaatgcatcaattgcgcattcacttgaacaaaattagtcatccgttgattggcgat
ccaaaatacggcgatcgttatcacaaccgaatgtttcaagcggaatttgagatttttgag
ctttttctacacgcagcttcgctttcgtttgtgcatccttttctacagaaaccaatggtg
attccgtgttcattcccaagacattggcataaaatttcagaaaaatgtaattgggatttg
acggatgattgttaa

DBGET integrated database retrieval system