KEGG   Kordia sp. SMS9: KORDIASMS9_03662Help
Entry
KORDIASMS9_03662  CDS       T05562                                 

Definition
(GenBank) glycosyl hydrolase family 30 TIM-barrel domain protein
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
kos  Kordia sp. SMS9
Pathway
kos00511  Other glycan degradation
kos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    KORDIASMS9_03662
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    KORDIASMS9_03662
Enzymes [BR:kos01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     KORDIASMS9_03662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C N-glycanase_N
Motif
Other DBs
NCBI-ProteinID: AXG71405
UniProt: A0A345H4B7
Position
complement(4171588..4173063)
Genome map
AA seq 491 aa AA seqDB search
MITACKEKEQKPLVKQLEAEVYETSESGNKLTKLTTFNSVKDTLTKTTLITLTPAKEYQT
ITGFGGAFTESSAYLLNKLSKKNRDFIIKAYFDKDHANYSLTRTHMNSCDFSLSNYSYTP
VAGDVNLEHFTIEEDMDDLIPMIKDAMAASQDGFKIFASPWTAAPWMKDNNAWVGGKLLK
KYYDTWALFFSKYVDAYKAEGIDIWGFTVENEPHGNGNNWESMHYTPEEMTDFVQNHLGP
KLEKDGKGDLIILGYDQNRAGLKEWVDVMFKDEASSKYYDGTAIHWYESTYKIYAEDLQY
AHNKAPNKYLIETEGCIDAQVPVWKDDAWYWKKEATDWGWDWAKEEEKYLHPKYAPVNRY
ARDIIGCLNNWVDGWVDWNMVLDKQGGPNWFKNWCIAPIIVDPDADEVYMTPLYYTMVHF
SKYIRPGAKIIDANNTDKDLMVTAAKNPDGSIAVVVFNEGKTEKYFSLHLGETSKSISIN
PQAIQTIVITN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgattacagcttgcaaagaaaaagagcaaaagcctttggtaaaacagcttgaagcagaa
gtatatgaaacttccgaaagtggaaacaaacttacaaaactaaccacattcaattcggta
aaagatacactgacaaaaacgactttgattacgttaactcctgcgaaagaataccaaacc
attacaggttttggaggcgcatttacggaatcatctgcgtatctattaaacaaattgagc
aaaaaaaatagagacttcattataaaagcatactttgataaagatcacgccaattactcg
cttacgcgtacacacatgaattcgtgcgacttttcattgtcaaactattcatatacacct
gtagctggcgatgtaaatttggaacactttaccattgaagaagatatggacgatctcatt
ccaatgattaaagatgccatggcagcttcacaagatggtttcaaaatatttgcatctccg
tggacagcagcaccttggatgaaagataacaatgcttgggtaggaggaaaactcttgaaa
aaatattacgatacatgggcattattcttctcaaaatatgtagatgcgtacaaagcagaa
ggtattgatatttggggattcaccgtagaaaatgaaccacatggaaacggaaacaactgg
gaaagtatgcactataccccagaagaaatgaccgatttcgtacaaaatcacttaggacca
aaacttgaaaaagacggaaaaggtgatttaatcattttaggatacgatcaaaatcgtgca
ggactcaaagaatgggtagacgtaatgtttaaagatgaagcttcttccaaatactatgac
ggaactgcaattcactggtatgaaagtacctataaaatatatgctgaagatttgcaatat
gcacacaacaaagcgccaaataaatatttaatagaaactgaaggctgtatagatgcacaa
gttcctgtttggaaagatgatgcttggtattggaaaaaagaagcaactgattggggttgg
gattgggcaaaagaagaagaaaaatacttgcacccaaaatatgctccagtaaatcggtat
gcacgtgatatcatcggatgtcttaacaattgggttgacggttgggtagactggaacatg
gtgttagacaaacaaggcggaccaaactggtttaaaaactggtgtatcgcgccaatcatc
gttgatccagatgcggatgaagtatacatgacgccattatattacaccatggtacatttc
agtaagtacattcgccctggcgcaaaaattatcgacgcaaacaacacagacaaagactta
atggtgactgcggcaaaaaatcctgacggaagcattgcggtagttgtattcaatgagggt
aaaaccgaaaaatacttttcacttcaccttggtgaaacatcaaaatcaatatcaattaac
ccacaagcgattcaaactatcgtgataaccaattaa

DBGET integrated database retrieval system