KEGG   Kordia sp. SMS9: KORDIASMS9_04377Help
Entry
KORDIASMS9_04377  CDS       T05562                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
kos  Kordia sp. SMS9
Pathway
kos00620  Pyruvate metabolism
kos00630  Glyoxylate and dicarboxylate metabolism
kos01100  Metabolic pathways
kos01110  Biosynthesis of secondary metabolites
kos01120  Microbial metabolism in diverse environments
kos01200  Carbon metabolism
Module
kos_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KORDIASMS9_04377 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    KORDIASMS9_04377 (aceB)
Enzymes [BR:kos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KORDIASMS9_04377 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI Cucumopine_C
Motif
Other DBs
NCBI-ProteinID: AXG72114
UniProt: A0A345H6C6
Position
complement(5014586..5016184)
Genome map
AA seq 532 aa AA seqDB search
MEETLLQQSKIQFANEVKNYYPEILNDEALQFITALHEQFNAKRLQVLERRKQQQNVFDA
GKFPEFPPETKEIREGEWKANNIPHDLQDRRVEITGPVDRKMIINALNSGAKTFMADLED
SNAPSWKNTIEGQQNLLDANKKTIALHDTKRNKFYQLNKETAVLLVRPRGLHLNERHLLI
NDEEASGSLVDFGLYVFHNTNIMLENNTAPYFYLPKLEHYLEARLWDEIFAFAENYLEVP
VGTFKATVLVETITASFQLDEIIYELKDHIVGLNCGRWDYIFSYIKKFRNHPNFVVPNRD
QVTMTTPFMDAYSKLVIQRCHKRGILAIGGMAAQIPIKNNKHANDAALEKVRKDKEREVQ
NGHDGTWVAHPALVVVAMNEFDTHMPTANQLHVSRNDINITEKDLVEIPKGTVTEAGIRK
NINVGILYIEAWLRGYGAVALYNLMEDAATAEISRTQVWQWLKNEVTLQDGRTFDKTLFT
DIFDDEVEKLITEVGEENMPQTKFSLAIALFKKLVTADEFEEFLTLPAYLHI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaactttattacaacagtctaaaattcagttcgctaacgaagtgaaaaattac
tatccagagatcctaaatgatgaagctttgcaattcattaccgctttgcatgaacagttt
aatgccaaacgtttgcaagtattagaaaggcgaaaacagcaacaaaacgtatttgatgca
ggaaagtttcctgaatttccaccagaaaccaaagaaatcagagaaggcgagtggaaagcc
aataatattccacacgatttgcaagaccgacgtgtagaaatcacaggtccggtagatcga
aaaatgatcatcaacgcactcaactctggcgcaaaaaccttcatggccgatttggaagac
agcaatgcaccaagttggaaaaacacgatcgaaggacaacaaaatctactcgatgccaac
aaaaaaacaatcgctctgcacgataccaaacgcaacaaattctatcaattaaataaagaa
actgctgtgttattagttcgcccaagaggtttacatttaaatgaacgacatcttctaata
aatgatgaagaagcttccggaagtttggtcgattttggattatatgtgttccacaacact
aacatcatgttagaaaacaataccgcaccgtatttttacttaccgaaactagaacactat
ttagaagcgcgtttgtgggatgaaatatttgcgtttgcagaaaactatctcgaagtacca
gttggaacattcaaagcaacggttttagtagaaacaatcacggcaagttttcaattagac
gaaatcatttacgaactcaaagatcatattgtcggactcaattgcggtcgttgggattac
attttctcatacatcaaaaaatttagaaaccatccaaattttgtcgtgcccaacagagat
caagtcacgatgacaacgccttttatggatgcatattcaaaattggtgattcagcgttgt
cacaaacgtggcatcttggctattggcggaatggcggcacaaattccgatcaaaaacaac
aaacacgccaacgatgccgccttagaaaaagtacgaaaagacaaagaacgcgaagtacaa
aacggacatgatggtacgtgggtagcacatccagcattggttgtcgttgcaatgaacgaa
tttgacacacacatgccaacggcaaatcaattacacgtttcgcgaaacgatatcaacatt
acagaaaaagacttggtagaaatccccaaaggaaccgtgacagaagcgggaattcgaaaa
aacatcaacgttggaatcttatacattgaagcgtggttgcgcggatatggagcagttgct
ttatacaatttaatggaagatgccgctacggcggaaatatctcgaacacaagtgtggcaa
tggctcaaaaacgaagtgacgcttcaagatggacgcacgtttgacaaaacattgtttaca
gacatctttgatgatgaagttgaaaaattgatcacggaagtgggcgaagaaaacatgcca
caaaccaaattcagtttggcaattgctctctttaaaaaactggtaacggcagacgaattt
gaagaatttttaacgcttccagcatatttacatatttaa

DBGET integrated database retrieval system