KEGG   Kosakonia sp. CCTCC M2018092: EH164_01570Help
Entry
EH164_01570       CDS       T05734                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
kot  Kosakonia sp. CCTCC M2018092
Pathway
kot00010  Glycolysis / Gluconeogenesis
kot00020  Citrate cycle (TCA cycle)
kot00620  Pyruvate metabolism
kot01100  Metabolic pathways
kot01110  Biosynthesis of secondary metabolites
kot01120  Microbial metabolism in diverse environments
kot01130  Biosynthesis of antibiotics
kot01200  Carbon metabolism
Module
kot_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EH164_01570 (pckA)
   00020 Citrate cycle (TCA cycle)
    EH164_01570 (pckA)
   00620 Pyruvate metabolism
    EH164_01570 (pckA)
Enzymes [BR:kot01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     EH164_01570 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AZI85835
UniProt: A0A3G9BFF0
Position
complement(346818..348437)
Genome map
AA seq 539 aa AA seqDB search
MRVKSLTPQDLKAYGINDVQDVVYNPDYETLYQEELRPDLEGYERGVLTTSGAVAVDTGI
FTGRSPKDKYIVRDDTTRDTVWWSDKGKGKNDNKPLSPEVWQHLKGLVTEQLSGKRLFIV
DAFCGANPDTRLAVRFITEVAWQAHFVKNMFIRPSDEELAEFTPDFIVMNGAKCTNPQWK
EQGLNSENFVAFNLTERIQLIGGTWYGGEMKKGMFSIMNYLLPLQGIASMHCSANVGEKG
DVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIRLSEEAEPDIF
HAIRRDALLENVSVRADGSIDFDDASKTENTRVSYPIYHIQNIVKPVSKAGHATKVIFLT
ADAFGVLPPVSRLTASQTQYHFLSGFTAKLAGTERGVTEPTPTFSACFGAAFLSLHPTQY
AEVLVKRMQASGAQAYLVNTGWNGTGKRISIKDTRAIIDAILNGSLDDAETFTLPMFDLA
IPTSLPGVESRILDPRGTYASPEQWQEKATQLAKLFIENFEKYTDTPAGAALVSAGPKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgttaagagtttaaccccgcaagatctcaaggcttatggaatcaacgatgttcag
gatgtcgtttacaaccccgattacgaaacgctgtatcaagaggaacttcgtccggacctg
gaagggtatgagcgcggcgtattgaccacctcaggcgcggttgccgtcgataccggcatc
tttaccggccgctcgccgaaggataagtacattgttcgcgatgacaccacgcgcgacacc
gtctggtggtctgataaaggcaaaggcaagaacgacaacaaaccgctctcgccggaagtg
tggcagcatctgaaaggcctcgtcaccgaacagctctccggcaagcgtctctttattgtc
gacgccttctgcggcgccaacccggacacccgcctcgcggtgcgctttattacagaagtg
gcctggcaggcacatttcgtcaaaaacatgtttattcgcccgagcgacgaagagctggca
gagttcacgccggactttatcgtgatgaacggcgcgaagtgcaccaacccgcagtggaaa
gagcagggcctcaactcagagaactttgttgccttcaacctgaccgaacgtatccagctg
attggcgggacgtggtacggcggtgagatgaagaaagggatgttctcaatcatgaactac
ctgctgccgctgcagggcattgcctcgatgcactgctcggcaaacgttggcgagaaaggc
gatgttgccgtcttctttggcctctccggcaccggtaaaactaccctctccaccgatccg
aagcgccgtctgattggcgatgatgagcacggctgggacgacgacggcgtcttcaacttt
gaaggcggctgctacgcgaaaaccattcgtctctctgaagaggcggagcccgatattttc
catgctattcgccgcgatgcgctgctggaaaacgtcagcgtacgcgccgatggcagcatc
gactttgacgatgcgtcgaaaaccgagaacacccgcgtctcctacccgatttaccatatc
cagaatattgttaaaccggtctcgaaagcgggtcacgccaccaaagtgatcttcctgacg
gcggatgcgttcggtgtgctgccaccggtatcgcgcctgactgccagccagacgcagtat
cacttcctctccggctttaccgctaaactcgccggcaccgagcgcggtgtcaccgagccg
acgccaaccttctccgcctgcttcggcgcagccttcctgtcgctgcacccgacgcagtat
gccgaagtgctggtaaaacgcatgcaggcttccggggcgcaggcttacctggtgaatacc
ggctggaacggcaccggcaaacgtatctccattaaggatacgcgcgcgatcatcgacgcc
attcttaatggttcgctggacgatgccgaaacctttaccctgccgatgtttgacctggcg
atcccgacctcactgccgggcgttgagagccgtattctcgatccgcgcggaacttacgcg
tcgccagagcagtggcaggagaaagccacgcagctggcgaaactctttatcgagaacttc
gagaagtataccgatacgcctgcgggtgccgcgctggtcagcgccgggccgaaactgtaa

DBGET integrated database retrieval system