KEGG   Kosakonia sp. CCTCC M2018092: EH164_07045Help
Entry
EH164_07045       CDS       T05734                                 

Gene name
hisP
Definition
(GenBank) histidine ABC transporter ATP-binding protein HisP
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
kot  Kosakonia sp. CCTCC M2018092
Pathway
kot02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kot00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EH164_07045 (hisP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kot02000]
    EH164_07045 (hisP)
Enzymes [BR:kot01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     EH164_07045 (hisP)
Transporters [BR:kot02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    EH164_07045 (hisP)
   Histidine transporter
    EH164_07045 (hisP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 AAA_16 ABC_ATPase AAA_23 G-alpha PRK AAA_33 Mg_chelatase RsgA_GTPase AAA_24 NACHT DUF87 ATPase_2
Motif
Other DBs
NCBI-ProteinID: AZI86826
UniProt: A0A3G9BRU5
Position
1488898..1489671
Genome map
AA seq 257 aa AA seqDB search
MSENKLNVTDLHKRYGQHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
TIVVSGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV
LGLSKQEARERAVKYLAKVGIDAMQQIKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPT
SALDPELVGEVLRIMQKLAEEGKTMVVVTHEMGFARDVSSHVIFLHQGKIEEEGTPDELF
GNPKSLRLQQFLKGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaataaattaaacgttaccgatctgcataagcgctacggccagcatgaagtt
ctgaaaggggtgtcgttgcaggctaacgccggggatgtgatcagcatcatcggctcctcc
ggctccggcaaaagcaccttcctgcgctgcatcaacttccttgagaaaccaagcgaaggc
accattgtggtgagcgggcagaatatcaatctggtgcgtgacaaagatggtcagctgaaa
gtggccgacaaaaatcagctgcgcctgctgcgcacgcgtctgacgatggtgttccagcac
ttcaatttgtggagccacatgacggtgctggagaacgtgatggaagcgccgattcaggtg
ctggggttaagcaagcaggaagcgcgcgagcgggcggtgaaatatctggcgaaagtgggc
atcgatgcgatgcagcagatcaagtatccggtgcatctctccggcggccagcagcagcgc
gtgtcgattgcccgcgcgctggcgatggagccggaagtgctgctgttcgatgaaccgacc
tcagccctcgatccggagctggtgggtgaagtgctgcgcatcatgcagaagctggcagaa
gaggggaaaaccatggtggtggttacccacgaaatgggcttcgcccgcgatgtctccagc
catgtgatcttcctgcatcagggcaaaattgaagaagagggcacgccggatgagctgttc
ggcaacccgaaaagcctgcgcttgcagcagttcctcaagggatcgctgaagtaa

DBGET integrated database retrieval system