KEGG   Kosakonia sp. CCTCC M2018092: EH164_13315Help
Entry
EH164_13315       CDS       T05734                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
kot  Kosakonia sp. CCTCC M2018092
Pathway
kot00480  Glutathione metabolism
kot00590  Arachidonic acid metabolism
kot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kot00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    EH164_13315
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EH164_13315
Enzymes [BR:kot01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     EH164_13315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AZI87982
UniProt: A0A3G9BLJ6
Position
complement(2790000..2790482)
Genome map
AA seq 160 aa AA seqDB search
MSTFHQLTATSLGGQPVPMADYAGKVVLVVNTASHCGFTPQYAGLETLYQKYAAQGLVVL
GFPCNQFGKQEPGSADDIAQTCHINYGVSFPMFAKIEVNGAAAHPLFRYLKKALPGVLGE
RIKWNFTKFLIGRDGKPIKRFAPFTKPEKIEAAIVAALES
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttttcatcaacttaccgccaccagccttggcggacagcctgttccgatggcc
gactacgcggggaaggtggtgctggtcgtcaataccgccagccattgcggcttcacgcca
caatatgccggcctcgaaacgctctaccagaaatatgccgcgcaggggctggtggtgctc
ggttttccctgcaaccagtttggtaaacaggagcccggcagcgcggatgacatcgcgcag
acctgccacattaactacggcgtcagctttccgatgtttgcaaaaatcgaggttaatggc
gccgccgcgcatccgctgtttcgttatctgaaaaaggcgctgcccggcgtgctgggagag
cgaattaagtggaacttcaccaagttcctgatcggccgcgatggcaaaccgattaagcgc
tttgcgccgtttaccaagccggagaaaatagaagccgccattgttgctgcgcttgaaagc
tga

DBGET integrated database retrieval system