KEGG   Kosakonia sp. CCTCC M2018092: EH164_18150Help
Entry
EH164_18150       CDS       T05734                                 

Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
kot  Kosakonia sp. CCTCC M2018092
Pathway
kot00540  Lipopolysaccharide biosynthesis
kot01100  Metabolic pathways
Module
kot_M00060  KDO2-lipid A biosynthesis, Raetz pathway, LpxL-LpxM type
Brite
KEGG Orthology (KO) [BR:kot00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    EH164_18150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:kot01003]
    EH164_18150
   01005 Lipopolysaccharide biosynthesis proteins [BR:kot01005]
    EH164_18150
Enzymes [BR:kot01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     EH164_18150
Glycosyltransferases [BR:kot01003]
 Polysaccharide
  Bacterial polysaccharide
   EH164_18150
Lipopolysaccharide biosynthesis proteins [BR:kot01005]
 Lipid A
  EH164_18150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB
Motif
Other DBs
NCBI-ProteinID: AZI88850
UniProt: A0A3G9BQE9
Position
complement(3813934..3815082)
Genome map
AA seq 382 aa AA seqDB search
MVDKRPLTIALVAGETSGDILGAGLIRALRARVPNARFVGVAGPRMQAEGCEAWYEMEEL
AVMGIVEVLGRLRRLLHIRADLTRRFSELQPDVFVGIDAPDFNITLEGNLKKRGIKTIHY
VSPSVWAWRQKRVFKIGKATDLVLAFLPFEKAFYDRFNVPCRFIGHTMADAMPLDPDKNA
ARVHLGISPQARCLALLPGSRGAEVEMLSADFLRTAQLLRERYPELEVVVPLVNAKRREQ
FERIKAEVAPDLTVHLLDGQAREAMIASDAALLASGTAALECMLAKCPMVVGYRMKPFTF
WLAKRLVKTPYVSLPNLLAGREVVKELLQEECQPQALAAALEPLLANSETRHEMHDLFRE
LHQRIRCNADEQAADAVLELAK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacaagcgtccgcttacgatagcccttgtcgccggagaaacctccggcgatatt
cttggtgccggtcttatccgcgcactgagagcgcgcgtgcccaacgcccgttttgttggc
gttgccggcccgcgtatgcaggctgaagggtgtgaagcctggtatgagatggaagagctg
gcggtgatggggatcgtcgaagtgcttggccgtctgcgtcgcctgctgcatatccgcgct
gatttgacccgtcgattcagcgagctgcaacccgatgtgtttgtcgggattgatgcgccg
gactttaacattacccttgagggtaatttaaaaaaacgcggcatcaaaacgattcactac
gtcagcccgtcagtctgggcgtggcgacaaaagcgcgttttcaaaattggtaaagccacc
gatctggtattggcatttctccctttcgaaaaagcgttttacgaccggtttaacgttcca
tgccgctttatcggacacaccatggccgatgccatgccgctcgatcccgataaaaatgcg
gcgcgcgtgcatctgggaattagcccgcaggcgcgctgcctggcgctgctgcccggcagc
cgtggtgcagaagtcgagatgctcagcgccgactttttgcgtaccgcacagctgctgcgt
gagcgctatccggagctggaagtcgtggttccgctggtcaatgcgaaacgccgcgagcag
tttgagcgcatcaaagcggaagtcgcgcctgatttgacggtgcacctgcttgatggccag
gcgcgggaagcgatgatcgcctccgatgccgcgctgctggcctccggcactgcggcgctg
gagtgcatgctggcgaaatgcccgatggtggtcggctaccgtatgaagcccttcaccttc
tggctggcgaaacgtctggtgaaaacgccttatgtttccttgccgaacctgctcgccggg
cgcgaagtggttaaagagctgttgcaggaggagtgtcagccgcaggcgctggcagccgca
ctggaaccgctgctggcgaacagtgaaacccgccatgaaatgcatgacctgtttcgcgag
ctgcatcagcgcatccgctgtaatgccgatgagcaggcggcggacgcggtactggagtta
gcaaaatga

DBGET integrated database retrieval system