KEGG   Klebsiella michiganensis KCTC 1686: KOX_02110Help
Entry
KOX_02110         CDS       T01681                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00071  Fatty acid degradation
kox00280  Valine, leucine and isoleucine degradation
kox00310  Lysine degradation
kox00362  Benzoate degradation
kox00380  Tryptophan metabolism
kox00620  Pyruvate metabolism
kox00630  Glyoxylate and dicarboxylate metabolism
kox00640  Propanoate metabolism
kox00650  Butanoate metabolism
kox00900  Terpenoid backbone biosynthesis
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01120  Microbial metabolism in diverse environments
kox01130  Biosynthesis of antibiotics
kox01200  Carbon metabolism
kox01212  Fatty acid metabolism
kox02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KOX_02110
   00630 Glyoxylate and dicarboxylate metabolism
    KOX_02110
   00640 Propanoate metabolism
    KOX_02110
   00650 Butanoate metabolism
    KOX_02110
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KOX_02110
   00072 Synthesis and degradation of ketone bodies
    KOX_02110
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KOX_02110
   00310 Lysine degradation
    KOX_02110
   00380 Tryptophan metabolism
    KOX_02110
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KOX_02110
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KOX_02110
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KOX_02110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kox04147]
    KOX_02110
Enzymes [BR:kox01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KOX_02110
Exosome [BR:kox04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KOX_02110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEX02163
UniProt: A0A0H3H1B5
Position
451918..453093
Genome map
AA seq 391 aa AA seqDB search
MNEVVIVSAKRTATGAFMGSLSGHSAAELGSHVIRALLEDSGVEASEISQVIMGQVLTAG
CGQNPARQSALNAGLPVETQCLTINKVCGSGLKSVHLAMLALQTGEAEFVIAGGQESMSN
APHILMASRSGTRLGDCNMRDSVVSDGLWDAFDNNHMGVTAENVAAEFSISREMQDEYAL
LSHIKAMDAQEKGIFAREIVPVEWQDRKGKTLRVDTDEGPRKTSIEKLMQLKPVFRKGGT
VTAGNASSLNDGAAAVLLCTRKTAEARGLPVLASLAAFANSGIKPALMGAAPVQAIADCL
SRSGWKPEDVDHLESNEAFAAQALAVIDQTGISPDRINPYGGAIALGHAIGASGCRILVT
LVHGLLRNDNKRGVAALCVGGGEGVALSVYR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagttgtgattgtttctgcaaaacgtactgcaacgggtgcattcatgggttcc
ctgtcgggccattccgcagcagaactcgggagtcacgtcattcgtgcgcttcttgaagac
tcaggagtggaggccagtgagatttctcaggttattatgggacaggtactgacggcagga
tgtggccagaatcccgcacgtcagtccgcgctgaatgccgggctacccgttgaaacgcaa
tgtctgacgattaacaaggtctgcggttcaggtctcaaatcagttcatctggccatgctg
gcgctgcagacgggtgaggcagaattcgtcattgccggcggtcaggaaagcatgtctaac
gcccctcatattctgatggcttcacgctccgggacaaggctgggggattgtaatatgagg
gatagcgtggtgtccgatggactctgggatgctttcgataataaccatatgggcgtcacc
gccgaaaatgttgcagctgagttcagcatcagtcgcgaaatgcaagatgaatacgcgctg
ctgtcccacataaaggcaatggatgctcaggaaaagggaatatttgctcgtgaaatagtt
cccgttgaatggcaggacaggaaaggcaaaaccctgagagttgacacggatgaaggcccc
cgcaaaaccagcattgaaaaactaatgcagctgaaacccgtattcagaaagggaggaact
gtgacggcaggtaatgcatcctctcttaatgatggcgcggccgctgtccttctttgtacc
agaaaaactgccgaggcacgtgggctgccggttttagcgtctcttgccgcgtttgcgaat
tcggggattaagccggcattaatgggtgccgctccggtacaggctatcgcagactgtctt
tcccgctctggctggaaaccagaagatgttgatcacctggagtccaatgaagcgtttgca
gcccaggcgctggcagtgattgaccagacgggtatttcacccgatcgtattaatccctat
ggcggagcaatcgcactcgggcatgctatcggtgcctcgggatgccgcattctggtcacc
ctcgtgcatggcctcctgcgtaatgataacaaacgcggtgttgcagcgctgtgtgttggc
ggcggtgaaggggtggcgctgagcgtttaccgctga

DBGET integrated database retrieval system