KEGG   Klebsiella michiganensis KCTC 1686: KOX_07260Help
Entry
KOX_07260         CDS       T01681                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00010  Glycolysis / Gluconeogenesis
kox00030  Pentose phosphate pathway
kox00051  Fructose and mannose metabolism
kox00052  Galactose metabolism
kox00680  Methane metabolism
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01120  Microbial metabolism in diverse environments
kox01130  Biosynthesis of antibiotics
kox01200  Carbon metabolism
kox01230  Biosynthesis of amino acids
kox03018  RNA degradation
Module
kox_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KOX_07260
   00030 Pentose phosphate pathway
    KOX_07260
   00051 Fructose and mannose metabolism
    KOX_07260
   00052 Galactose metabolism
    KOX_07260
  Energy metabolism
   00680 Methane metabolism
    KOX_07260
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    KOX_07260
Enzymes [BR:kox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KOX_07260
Protein phosphatases and associated proteins [BR:kox01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KOX_07260
Messenger RNA biogenesis [BR:kox03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     KOX_07260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEX03182
UniProt: A0A0H3H698
Position
1519679..1520641
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFREEHIRAVAIENMRKRGLDALVVIGGDGSYMGAVRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAISGGCEFIMVPEVEYTRDDLVSEIKAGIAKGKKHAIVAITEHMCDVDELAHYIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLQGFGGRCVGIQNEKLVHHDIIDA
IENMKRPFKSDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagtggcggtgatgccccgggcatgaacgcagca
attcgtggcgttgtgcgtgcggcattaacggaaggtctggaagtttttggaatctatgac
ggttacctcggcctgtatgaagatcgtatggttcagctcgaccgctacagcgtttccgac
atgatcaaccgcggcggcaccttcctggggtcggcgcgttttccagaattccgcgaagaa
catattcgcgccgtcgcgattgaaaatatgagaaagcgcggcctggatgcgctggtggtt
atcggtggtgacggttcctatatgggcgccgtgcgtctgactgagatgggcttcccttgc
atcggtctgccgggcaccatcgacaacgatattaaaggcaccgactataccattggcttc
tttaccgcattgagcaccgtggtagaggccattgaccgcctgcgtgacacctcttcctcc
caccagcgtatttccgttgttgaagtaatgggccgctactgcggcgatctgaccctggcg
gcagctatctccggcggctgtgagttcatcatggtgcctgaggttgaatacacgcgcgac
gacctggtttcagaaattaaggcgggtatcgcgaaaggcaaaaaacacgcgattgtggcg
atcaccgagcatatgtgcgacgtcgacgagctggctcactacatcgagaaagagaccggc
cgtgaaacgcgtgccaccgtactgggccacattcagcgcggcggctctccggttccttat
gaccgtattctggcatcccgcatgggcgcgtacgcgattgacctgctgctgcagggcttc
ggcggccgctgcgttggtattcagaacgagaagctggttcaccacgacattatcgacgct
atcgaaaacatgaagcgtccgttcaaaagcgactggctggattgcgctaagaagctgtac
taa

DBGET integrated database retrieval system