KEGG   Klebsiella michiganensis KCTC 1686: KOX_10690Help
Entry
KOX_10690         CDS       T01681                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
kox  Klebsiella michiganensis KCTC 1686
Brite
KEGG Orthology (KO) [BR:kox00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    KOX_10690 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Pax2_C DUF4354
Motif
Other DBs
NCBI-ProteinID: AEX03864
UniProt: A0A0H3H5Q4
Position
complement(2286210..2286587)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCVQVQSVYIESQSSPQEERYVFAYTVTIRNLGRTQVQLLGRYWLITNGHGRET
EVQGEGVVGEQPHIPAGGEYQYTSGAVIETPLGTMQGHYAMIDVNGAPFTIEIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattaattcgccccgagtttgtgtacaggtgcaaagcgtctacatcgaatcgcaatct
tctccgcaagaagagcgctacgtcttcgcttataccgtgaccattcgcaatctggggcgg
acgcaggttcagcttcttggccgctactggcttatcaccaacggccacggtcgtgagacc
gaagtccagggtgaaggcgtggtcggcgagcagccgcatattccggccggcggcgaatat
caatataccagcggcgcggtcattgaaacgccgctgggcaccatgcagggacattatgcg
atgatcgatgtgaacggcgcgccgttcaccatcgaaatccctgttttccgtctcgcagta
cccactctcatccattaa

DBGET integrated database retrieval system