KEGG   Klebsiella michiganensis KCTC 1686: KOX_13405Help
Entry
KOX_13405         CDS       T01681                                 

Definition
(GenBank) amidohydrolase
  KO
K01451  hippurate hydrolase [EC:3.5.1.32]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00360  Phenylalanine metabolism
kox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kox00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    KOX_13405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:kox01002]
    KOX_13405
Enzymes [BR:kox01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.32  hippurate hydrolase
     KOX_13405
Peptidases and inhibitors [BR:kox01002]
 Metallo peptidases
  Family M20
   KOX_13405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AEX04405
UniProt: A0A0H3HDA7
Position
2896721..2897899
Genome map
AA seq 392 aa AA seqDB search
MTDCVIPEIKATEDEMIAIRHYLHAHPELSLEEFNTSELVAGKLAEWGYTVTRGLAKTGV
VGTLSKGDSPRTIGLRADMDALPIFEATDLPWASTVAGKMHACGHDGHTTILLAAAKYIA
SPACQFNGTVHLIFQPAEEAIGGADLMIKDGLFERFPCERIFGLHNMPGLPVGKIGFYAG
NFMASADTVKITITGYGGHGAHPERTVDPIVTGAALVMNLQSIVARNVPPGETAVVSVGT
FQAGIASNVIPENVVMELSVRAMKPEIRDLLIKRIKELTDFTAKSYGASSEVAVFDSYPV
LTNSVEETEFAKALALDVFGEEGVLESISPMNASEDFAFMLQQRPGCYFLLGNGEKGGKG
SCMVHNPGYDFNDDIISTGATLFARLVETHCR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactgtgtaattcctgaaattaaagccaccgaagatgaaatgattgcgatccgt
cattatttacacgcccatccggaattaagcctggaagagtttaataccagcgagctggtg
gccggaaaactggccgagtggggctatacggtgacccgcgggctggcgaaaaccggggtg
gtaggaacgttaagcaagggcgattcgccgcgcactatcggcctgcgcgccgacatggac
gcgctgccgattttcgaagcgaccgatctcccctgggccagcaccgtggccggaaaaatg
cacgcctgcggccacgacggccacaccaccattctgctggcggcggcgaaatatatcgcc
tcgccggcctgccagttcaacggcacggtacacctgattttccagcccgcggaagaagcg
atcggcggcgcggatttaatgatcaaagacggcctgtttgagcgctttccctgcgagcgc
atcttcggcctgcacaatatgccgggcctgccggtggggaaaatcggcttttacgccggg
aattttatggcctcggcggatacggtaaaaatcaccattaccggctacggcggccacggc
gcgcaccccgagcgcaccgtcgatcccattgttaccggcgcggcgctggtgatgaatctg
caaagcatcgttgcgcgtaacgtaccgccgggcgaaaccgcggtggtgagcgtcggcacc
ttccaggcgggtatcgcctccaacgtcatccctgagaacgtggtgatggagctgagcgtg
cgggcgatgaagccggaaattcgcgacctgctgattaagcggatcaaggagctcactgat
tttaccgccaaaagctacggcgccagcagcgaggtagcggtttttgactcctatccggta
ctgaccaacagcgtcgaagagaccgaattcgccaaagcgctggcgctggacgtctttggc
gaggagggcgtgctggaatccatttcgccgatgaacgccagcgaagatttcgcctttatg
ctccagcagcgccccggctgctacttcctgctgggcaatggcgagaaaggcgggaagggc
agctgtatggtgcacaaccccggctatgactttaatgatgacattatttctaccggcgcg
acgctgttcgcccggttagttgaaacacactgccgttga

DBGET integrated database retrieval system