KEGG   Klebsiella michiganensis KCTC 1686: KOX_14600Help
Entry
KOX_14600         CDS       T01681                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00020  Citrate cycle (TCA cycle)
kox00640  Propanoate metabolism
kox00660  C5-Branched dibasic acid metabolism
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01120  Microbial metabolism in diverse environments
kox01130  Biosynthesis of antibiotics
kox01200  Carbon metabolism
Module
kox_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kox_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KOX_14600 (sucC)
   00640 Propanoate metabolism
    KOX_14600 (sucC)
   00660 C5-Branched dibasic acid metabolism
    KOX_14600 (sucC)
Enzymes [BR:kox01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     KOX_14600 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A BAT
Motif
Other DBs
NCBI-ProteinID: AEX04644
UniProt: A0A0H3H818
Position
3169620..3170786
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVKSKEDIRAFAEHWLGKRLVTYQTDANGQPVNQILVEAATDIDKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKIAIDPLAGPMPYQGRELAFKLGLEGKQVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggcaaaacaactctttgcccgctatggcttaccggcgccg
gtgggttatgcctgtactactccgcgtgaagcagaagaagccgcttcaaaaatcggcgcg
ggtccgtgggtagtgaaatgtcaggttcacgctggtggccgcggcaaagcgggcggtgtg
aaagtagtgaagagcaaagaagacattcgcgcatttgctgaacactggctgggcaaacgc
ctcgtcacctatcaaacagatgcgaacggccagccggttaaccagattctggttgaagcg
gcgaccgatattgataaagagctgtacctgggcgcggttgttgaccgtagctcccgtcgc
gtggtctttatggcctctaccgaaggcggcgtggaaatcgaaaaagtggcggaagagacc
ccgcacctgatccacaaaatcgccatcgatccgctggcgggtccgatgccttaccagggc
cgcgaactggcgttcaaactgggtctggaaggtaaacaggttcagcagttcaccaaaatc
tttatgggcctggcgaccattttccttgagcgcgatctggcgctgatcgaaatcaacccg
ctggtgatcactaagcagggcgacctgatctgtctcgacggtaaactgggcgctgacggc
aacgcgctgttccgccagccggacctgcgcgaaatgcgcgaccagtcgcaggaagacccg
cgcgaggctcaggcggcgcagtgggagctgaactacgtcgcgctggacggcaacatcggc
tgcatggtgaacggcgcgggcctggccatgggcaccatggacatcgttaagctgcacggc
ggcgaaccggctaacttcctcgacgttggcggcggcgcaaccaaagagcgcgtcaccgaa
gcgtttaaaatcatcctctctgacgacaacgtaaaagcggttctggttaacatcttcggc
ggtatcgtacgctgcgacctgattgccgacggcatcatcggcgcggtagccgaagtgggc
gttaacgtcccggtagtggttcgtctggaaggtaacaacgccgaactgggcgcgaagaaa
ctggctgacagcggcctgaatattattgcagcgaaaagtctgacggatgcagctcagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system