KEGG   Klebsiella michiganensis KCTC 1686: KOX_15770Help
Entry
KOX_15770         CDS       T01681                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00260  Glycine, serine and threonine metabolism
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01120  Microbial metabolism in diverse environments
kox01130  Biosynthesis of antibiotics
kox01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kox00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KOX_15770
Enzymes [BR:kox01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     KOX_15770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AEX04878
UniProt: A0A0H3H963
Position
complement(3396407..3397408)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPGRAMLEAMMAAPVGDDVYGDDPTVNELQRFAANLAGKEAAIFLPSGTQ
ANLVALLSHCQRGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAADGSLPLDKVAAKI
KPDDIHFAPTRLLSLENTHNGKVLPREYLKDAWEFTRQRGLGLHVDGARIFNAVVEYGCA
LREIARYCDSFTICLSKGLGAPVGSLLVGSEEYIHRAIRWRKMVGGGMRQAGILAAAGLY
ALQNNVARLKEDHDNAAWMAEQLRAAGAEVTRHDTNMLFVRVGEARAAALGEYLRERGVL
INASPIVRLVTHIDVNRQQLTEVVSHWQAFLNR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatagatttacgcagcgataccgttacccgtccgggccgcgccatgctggaagccatg
atggccgccccggtcggggatgacgtgtatggcgatgacccgaccgttaacgaactccag
cgctttgccgccaacctggcgggcaaagaggccgctatcttcctgcctagcggcacccag
gccaacctggtcgccctgctcagccactgccagcgcggtgaagagtatatcgtcggccag
ggcgcgcataactatctctacgaagccggcggcgcggcggtgcttggcagcatccagccg
cagccaatcgatgccgcagcggacggttccctgccgctggataaagtcgcggccaaaatc
aaaccggacgatatccatttcgcccctacccggctgctgtcgctggaaaacacccataac
ggcaaagtgctgccgcgtgaatatctcaaagatgcctgggagtttacgcgccagcgcggc
ctggggctgcacgttgacggggcgcgtatttttaacgccgtcgtggaatacggctgcgcg
ctgcgcgagatcgcccgctactgcgactccttcaccatctgcctgtctaaaggactcggc
gcgccggtaggctcgctgctggtggggagcgaagagtacattcaccgcgctatccgctgg
cggaaaatggtcggcggcgggatgcgtcaggccggtattctggcggccgcgggcctgtat
gccctgcagaacaacgtcgcgcgcttaaaagaggatcacgacaacgccgcgtggatggcg
gagcagctgcgcgccgccggcgccgaggtgacgcgtcatgataccaatatgctgtttgtt
cgcgtcggtgaagcgcgcgccgccgcgctgggcgagtatctgcgcgaacgaggggtgctg
atcaacgcctcgcccatcgtgcgcctggtgacgcatattgacgttaaccgccagcagctc
accgaggtggttagccactggcaggcatttttaaaccgttaa

DBGET integrated database retrieval system