KEGG   Klebsiella michiganensis KCTC 1686: KOX_18325Help
Entry
KOX_18325         CDS       T01681                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00260  Glycine, serine and threonine metabolism
kox00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01130  Biosynthesis of antibiotics
kox01230  Biosynthesis of amino acids
Module
kox_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KOX_18325 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KOX_18325 (trpA)
Enzymes [BR:kox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KOX_18325 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Amidohydro_2 His_biosynth HMGL-like
Motif
Other DBs
NCBI-ProteinID: AEX05387
UniProt: A0A0H3HD15
Position
complement(3962442..3963251)
Genome map
AA seq 269 aa AA seqDB search
MERYETLFAQLKARREGAFVPFVTLGDPNPEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQDATLRAFAAGVTPAQCFEMLTAIRQKHPTIPIGLLMYANLVFSPGIDEFYAACER
AGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLHHLIEKLAEYHAAPPLQGFGISAPEQVTAAIEAGAAGAISGSAIVKI
IERNVNDPQAMLAELKAFARSLKAATKAA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttatgagacgctgtttgcacaactgaaagctcgccgggaaggcgcgtttgtt
cccttcgtcaccctcggcgatccgaatccggaacagtcgctgaaaattatcgatacgctg
attgaagccggtgccgacgcgctggagctgggcattcctttctccgacccgctggcggat
ggcccgaccattcaggacgccaccctgcgcgcttttgccgccggggtgacccccgcgcag
tgcttcgaaatgctgacggcgattcgccagaaacaccctaccattcctatcggcctgctg
atgtacgccaacctggtgttcagccccggcatcgatgaattctacgccgcgtgtgaacgc
gcgggcgtcgattccgtgctggttgccgatgttcccgtggaagagtccgcgccgttccgc
caggccgcgctgcgccacaatatcgcgccgattttcatctgcccgcccaatgccgatgac
gatctgctgcgccagatagcctcttacggtcgcggttatacttacctgctgtcgcgggcg
ggcgtgaccggcgcggaaaaccgcgccgcgctgccgctgcatcatctgattgaaaagctg
gccgagtaccacgccgcgccgccgctgcagggctttggcatctcggcgccggagcaggtt
accgccgcgattgaggccggcgcggccggcgcgatttccggctcagccatcgtcaaaatc
atcgaacggaacgtgaatgatccgcaggccatgctggcggaactcaaggctttcgcccga
agcctgaaagccgccactaaagcggcttaa

DBGET integrated database retrieval system