KEGG   Klebsiella michiganensis KCTC 1686: KOX_18335Help
Entry
KOX_18335         CDS       T01681                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01130  Biosynthesis of antibiotics
kox01230  Biosynthesis of amino acids
Module
kox_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KOX_18335
Enzymes [BR:kox01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     KOX_18335
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     KOX_18335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C Adenine_deam_C
Motif
Other DBs
NCBI-ProteinID: AEX05389
UniProt: A0A0H3HAB1
Position
complement(3964454..3965812)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEVVPTQRNFYDALAGTRTAFILECKKASPS
KGLIREDFDPAAIAGVYKHYASAISVLCDEKYFQGSFDFLPMVSKVAPQPILCKDFTIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLSAVAHSLNMGVLTEVSNEEELERAIALKAKV
VGINNRDLRDMSIDLNRTRTLAPKLGHDVTVISESGIHTYAEVRELSHFANGFLIGSALM
EHADLNAAVKRVLLGENKVCGLTRPQDAQVAYESGAVYGGLIFVPTSPRAVNEAQAQAVI
ASAPLSYVGIFRNTPMAEVIARAENLDLAAVQLHGSEDQTYIDTLRAELPPKVQIWKALS
VGETLPPRELRHVDKYVLDNGQGGTGQRFDWSLLQGQDLHNVMLAGGLSADNCVEAAKSG
CAGLDFNSGVESQPGIKDADKLSSVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgttttagcaaaaatcgtggccgacaaagcgatttgggtagaagcccgcaaa
caacaacaaccgttagccagttttcaaaatgaagtggtaccgacgcagcgcaatttttat
gatgccctcgccggaacccgcaccgcgtttattctcgagtgcaaaaaggcctcgccatca
aaaggcctgattcgcgaagattttgacccggcggccatcgccggcgtctacaagcactac
gcctcggctatctcggtgctgtgcgatgagaaatatttccagggcagcttcgatttcctg
ccgatggtcagtaaggtcgcgccgcagccgattctctgtaaggacttcaccatcgatcct
tatcagatttacctggcgcgctactaccaggccgacgcctgtctgctgatgctttcagtg
ctggatgatgagcagtatcgccagctctccgccgtcgcgcacagcctgaacatgggcgtg
ctgaccgaagtgagtaatgaagaggagctggagcgcgcgattgcgctgaaggcgaaagta
gtcggcatcaacaaccgcgatctgcgcgatatgtcgattgatctcaaccgtacccgtacc
ctggcgcctaagctcggtcacgatgtcacggtgatcagcgagtccggcatccatacctac
gcggaagtgcgcgaactgagccacttcgccaacggtttcctgattggctcagcgctgatg
gagcacgccgatctcaacgccgccgtgaagcgcgtgctgctcggcgagaataaggtctgc
ggcctgacccgcccccaggatgcccaggtggcgtatgaatccggcgcggtctacggcggc
ctgatttttgtcccgacgtcgccgcgcgcggtgaacgaggcgcaggcgcaagcggtgatc
gccagcgcgcctctgagctatgtcggcatattccgcaataccccgatggcggaagtgatc
gcccgggcggaaaacctcgacttagccgccgtacagctgcacggcagcgaagaccagacc
tatattgataccctgcgcgccgaacttccgccgaaggtgcaaatctggaaagccctcagc
gtaggtgaaacgctaccgccgcgcgagctgcgccatgtcgataaatacgttctcgacaac
ggtcagggcggcaccggccagcgtttcgactggtccctgctgcagggccaggacctgcat
aacgtcatgctggcaggcggcctcagcgccgataactgcgtagaagccgccaaaagcggc
tgtgccggactcgattttaattcaggcgtagagtcgcagccgggtattaaagatgccgac
aagctgtcctctgtgtttcaaacgctgcgcgcatattaa

DBGET integrated database retrieval system