KEGG   Klebsiella michiganensis KCTC 1686: KOX_18800Help
Entry
KOX_18800         CDS       T01681                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kox00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KOX_18800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kox02044]
    KOX_18800
Secretion system [BR:kox02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KOX_18800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AEX05482
UniProt: A0A0H3HDA8
Position
4062708..4063199
Genome map
AA seq 163 aa AA seqDB search
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFL
FTKEIDASSPYLYKAVTTGQTLKSAEFRWYKINDAGQEVEYFNTKLENVKVVKVNPLMHD
VKDPSYEKHNHLEQIELRYEKITWTYKDGNIIHSDSWNERATA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcaattccagtctatctgtggctgaaggacgacggcggcgcggacatcaaaggttcc
gtggacgtgaaggaccgcgagggcagcatcgaggtggtggcgcaggagcataacctgtac
atcccgaccgacaacaacaccgggaagctgaccggcacgcgtatccacacgccgttcttg
ttcaccaaggaaatcgacgcctccagcccgtacctgtacaaggcggtgaccaccggccag
acgctgaagtcggcggagttccgctggtacaaaatcaacgacgccggtcaggaagtggag
tacttcaacacgaagcttgagaacgtgaaggtggtgaaggtcaacccgctgatgcacgac
gtcaaggacccgtcctacgagaagcataaccacctcgagcagattgagctgcgttacgaa
aaaatcacctggacctacaaggacggcaacatcattcattccgacagctggaacgaacgc
gccaccgcctga

DBGET integrated database retrieval system